(data stored in ACNUC18858 zone)

EMBL: AF465338

ID   AF465338; SV 1; linear; genomic DNA; STD; MAM; 1323 BP.
XX
AC   AF465338;
XX
DT   15-JAN-2003 (Rel. 74, Created)
DT   18-JAN-2003 (Rel. 74, Last updated, Version 2)
XX
DE   Bos taurus core 2 beta-1,6-N-acetylglucosaminyltransferase (C2GnT-M) gene,
DE   complete cds.
XX
KW   .
XX
OS   Bos taurus (cattle)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Laurasiatheria; Artiodactyla; Ruminantia; Pecora; Bovidae;
OC   Bovinae; Bos.
XX
RN   [1]
RP   1-1323
RX   DOI; 10.1128/JVI.77.3.1784-1792.2003.
RX   PUBMED; 12525612.
RA   Markine-Goriaynoff N., Georgin J.-P., Goltz M., Zimmermann W., Broll H.,
RA   Wamwayi H.M., Pastoret P.-P., Sharp P.M., Vanderplasschen A.;
RT   "The core 2 beta-1,6-N-acetylglucosaminyltransferase-mucin encoded by
RT   bovine herpesvirus 4 was acquired from an ancestor of the African buffalo";
RL   J. Virol. 77(3):1784-1792(2003).
XX
RN   [2]
RP   1-1323
RA   Markine-Goriaynoff N., Georgin J.-P., Goltz M., Zimmermann W., Broll H.,
RA   Wamwayi H.M., Pastoret P.-P., Sharp P., Vanderplasschen A.;
RT   ;
RL   Submitted (05-JAN-2002) to the INSDC.
RL   Department of Infectious and Parasitic Diseases, University of Liege,
RL   Boulevard de Colonster, 20. B43 bis, Liege, Liege B-4000, Belgium
XX
DR   MD5; 67cd68bdb47330a26bc45483f0846e13.
DR   Ensembl-Gn; ENSBTAG00000009443; bos_taurus.
DR   Ensembl-Tr; ENSBTAT00000012427; bos_taurus.
DR   EuropePMC; PMC140990; 12525612.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1323
FT                   /organism="Bos taurus"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9913"
FT   mRNA            <1..>1323
FT                   /gene="C2GnT-M"
FT                   /product="core 2 beta-1,6-N-acetylglucosaminyltransferase"
FT   CDS_pept        1..1323
FT                   /codon_start=1
FT                   /gene="C2GnT-M"
FT                   /product="core 2 beta-1,6-N-acetylglucosaminyltransferase"
FT                   /db_xref="GOA:Q7YQE1"
FT                   /db_xref="InterPro:IPR003406"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7YQE1"
FT                   /protein_id="AAO22165.1"
FT                   /translation="MKMTGWKKKLCRGHHLWALGCYMLLAVVALRLSLRLKCDVDSLDL
FT                   ESRDFQSQRCRDVLYKNLKLPAKRSISCSGITRGDQEAVVQALLDNLEVKKKRLPFTDT
FT                   YYLNITRDCEQFKAQRKFIQFPLSKEELDFPIAYSMVVHEKIENFERLLRAVYAPQNIY
FT                   CVHVDVKSPETFKEAVKAIISCFPNVFMASKLVPVVYASWSRVQADLNCMEDLLQSSVP
FT                   WKYLLNTCGTDFPIKTNAEMVLALKMLNGKNSMESEIPSEYKKNRWKYRYEVTDRLYLT
FT                   SKMKDPPPDNLPMFTGNAYFVASRAFVQHVLENPKSQRLIEWVKDTYSPDEHLWATLQR
FT                   APWMPGSVPYHPKYHISDMTAIARLVKWQGHEGDVSMGAPYAPCSGIHQRAICIYGAGD
FT                   LHWILQNHHLLANKFDPRVDDNVLQCLEEYLRHKAIYGTEL"
XX
SQ   Sequence 1323 BP; 340 A; 328 C; 341 G; 314 T; 0 other;
     atgaagatga ctgggtggaa gaagaagctt tgccgggggc atcatctgtg ggctctgggc        60
     tgctatatgc tgctggccgt tgttgctctg aggctttctc tcaggttgaa atgtgatgta       120
     gattccttgg atctggagtc cagggacttc caaagtcagc gttgtaggga cgtcttgtac       180
     aagaacctga agctgccagc aaagagatcc atcagctgtt ctgggatcac acgaggggac       240
     caggaagcgg tggtccaggc tctcctggac aacctggaag tcaagaagaa gcggttgcct       300
     ttcactgaca cctattacct caacataacc agagactgtg agcagtttaa ggcccaaagg       360
     aagttcatac agttcccact gagcaaagaa gagttagact tccccattgc atactcgatg       420
     gtggtccatg agaagattga aaactttgaa cggctgctgc gagctgtgta tgcccctcag       480
     aacatatact gtgtccatgt ggatgtgaag tccccagaaa ctttcaaaga ggcagtcaag       540
     gccattattt cctgcttccc caatgtcttc atggccagta agttggtccc agtggtttat       600
     gcctcctggt ccagagtgca ggctgacctg aactgtatgg aagacttgct ccagagctcg       660
     gtgccatgga aatacttact gaatacatgt gggacagact tccccataaa gaccaacgcc       720
     gagatggttc tggccctcaa gatgttgaat gggaagaaca gtatggagtc tgagatacct       780
     tctgagtaca aaaaaaatcg ctggaaatac cgctatgagg tgacagacag actgtaccta       840
     accagcaaga tgaaggaccc tccccctgat aatttaccta tgttcacggg gaatgcctat       900
     tttgtggctt ctcgagcctt tgtccaacat gtcttagaga accccaaatc ccaaagactg       960
     attgaatggg tcaaagacac ctatagcccc gacgaacacc tctgggccac ccttcagcgt      1020
     gctccatgga tgcctggctc tgttccttac caccccaagt atcacatctc agacatgact      1080
     gccatcgcca ggctggtcaa gtggcagggc cacgagggag atgtcagcat gggggcgcct      1140
     tatgcaccct gctctggaat ccatcagcgg gccatctgca tttacggggc cggggacctg      1200
     cactggattc tccagaacca tcacctcttg gcaaacaagt ttgacccaag ggtggatgat      1260
     aacgtcctgc agtgcttaga agagtattta cgtcataagg ccatctatgg gactgaactt      1320
     tga                                                                    1323
//

If you have problems or comments...

PBIL Back to PBIL home page