(data stored in ACNUC8465 zone)

EMBL: AF498971

ID   AF498971; SV 1; linear; mRNA; STD; HUM; 591 BP.
XX
AC   AF498971;
XX
DT   03-MAY-2002 (Rel. 71, Created)
DT   03-MAY-2002 (Rel. 71, Last updated, Version 1)
XX
DE   Homo sapiens small GTP binding protein RhoB (ARHB) mRNA, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-591
RA   Puhl H.L.III., Ikeda S.R., Aronstam R.S.;
RT   "Human Rho family small GTP binding protein RhoB";
RL   Unpublished.
XX
RN   [2]
RP   1-591
RA   Puhl H.L.III., Ikeda S.R., Aronstam R.S.;
RT   ;
RL   Submitted (05-APR-2002) to the INSDC.
RL   cDNA Resource Center, Guthrie Research Institute, One Guthrie Square,
RL   Sayre, PA 18840, USA
XX
DR   MD5; 836db97a6b4e72b59d4a60844d7fa24f.
DR   Ensembl-Gn; ENSG00000143878; homo_sapiens.
DR   Ensembl-Tr; ENST00000272233; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..591
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /tissue_type="brain"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        1..591
FT                   /codon_start=1
FT                   /gene="ARHB"
FT                   /product="small GTP binding protein RhoB"
FT                   /note="small GTP binding protein; Rho family member"
FT                   /db_xref="GOA:P62745"
FT                   /db_xref="H-InvDB:HIT000080908.13"
FT                   /db_xref="HGNC:HGNC:668"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003578"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="PDB:2FV8"
FT                   /db_xref="UniProtKB/Swiss-Prot:P62745"
FT                   /protein_id="AAM21118.1"
FT                   /translation="MAAIRKKLVVVGDGACGKTCLLIVFSKDEFPEVYVPTVFENYVAD
FT                   IEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWVPEVK
FT                   HFCPNVPIILVANKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDYLECSAKT
FT                   KEGVREVFETATRAALQKRYGSQNGCINCCKVL"
XX
SQ   Sequence 591 BP; 120 A; 182 C; 194 G; 95 T; 0 other;
     atggcggcca tccgcaagaa gctggtggtg gtgggcgacg gcgcgtgtgg caagacgtgc        60
     ctgctgatcg tgttcagtaa ggacgagttc cccgaggtgt acgtgcccac cgtcttcgag       120
     aactatgtgg ccgacattga ggtggacggc aagcaggtgg agctggcgct gtgggacacg       180
     gcgggccagg aggactacga ccgcctgcgg ccgctctcct acccggacac cgacgtcatt       240
     ctcatgtgct tctcggtgga cagcccggac tcgctggaga acatccccga gaagtgggtc       300
     cccgaggtga agcacttctg tcccaatgtg cccatcatcc tggtggccaa caaaaaagac       360
     ctgcgcagcg acgagcatgt ccgcacagag ctggcccgca tgaagcagga acccgtgcgc       420
     acggatgacg gccgcgccat ggccgtgcgc atccaagcct acgactacct cgagtgctct       480
     gccaagacca aggaaggcgt gcgcgaggtc ttcgagacgg ccacgcgcgc cgcgctgcag       540
     aagcgctacg gctcccagaa cggctgcatc aactgctgca aggtgctatg a                591
//

If you have problems or comments...

PBIL Back to PBIL home page