(data stored in ACNUC16935 zone)

EMBL: AF506969

ID   AF506969; SV 1; linear; mRNA; STD; MAM; 1157 BP.
XX
AC   AF506969;
XX
DT   27-MAY-2002 (Rel. 71, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Equus caballus ubiquitin mRNA, complete cds.
XX
KW   .
XX
OS   Equus caballus (horse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
XX
RN   [1]
RP   1-1157
RA   Takafuji V.A., Sharova L.V., Crisman M.V., Howard R.D.;
RT   "Equus caballus ubiquitin mRNA";
RL   Unpublished.
XX
RN   [2]
RP   1-1157
RA   Takafuji V.A., Sharova L.V., Crisman M.V., Howard R.D.;
RT   ;
RL   Submitted (29-APR-2002) to the INSDC.
RL   Large Animal Clinical Sciences, Orthopedic Research Laboratory, VA-MD
RL   Regional College of Veterinary Medicine, Virginia Polytechnic Institute and
RL   State University, Duckpond Drive, Blacksburg, VA 24061, USA
XX
DR   MD5; d86c95f179ad8fd7f62c77ef0174bfcd.
DR   EuropePMC; PMC1484482; 16643647.
DR   EuropePMC; PMC2412902; 18489742.
DR   EuropePMC; PMC2797813; 20003356.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1157
FT                   /organism="Equus caballus"
FT                   /mol_type="mRNA"
FT                   /cell_type="LPS-stimulated peripheral blood mononuclear
FT                   cells"
FT                   /db_xref="taxon:9796"
FT   CDS_pept        119..1036
FT                   /codon_start=1
FT                   /product="ubiquitin"
FT                   /db_xref="GOA:Q8MKD1"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8MKD1"
FT                   /protein_id="AAM34211.1"
FT                   /translation="MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIF
FT                   AGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKA
FT                   KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK
FT                   TITLEVEPSDTIENVKAKIQDKEGIPPDQQRFIFAGKQLEDGRTLSDYNIQKESTLHLV
FT                   LRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDG
FT                   RTLSDYNIQKESTLHLVLRLRGGC"
XX
SQ   Sequence 1157 BP; 286 A; 319 C; 323 G; 229 T; 0 other;
     aattcggcac gagcggcacg agcggcacga gcggcacgag gccttttggt gtggtattgc        60
     tgaggtgatt tggcgtggtt tggattagca gtttcttcgt gtccgtcacc aggtcaaaat       120
     gcagatcttt gtgaagaccc tgaccggcaa gaccatcacc ctggaggtgg agcccagcga       180
     caccatcgag aacgtcaagg ccaagatcca ggataaggag ggcatccccc ccgaccagca       240
     gaggctcatc tttgcaggca agcagctgga agatggccgc actctttccg attacaacat       300
     ccagaaagag tcgaccctgc acctggtgct gcgcctgaga ggcggtatgc agattttcgt       360
     gaagaccctg accggcaaga ccatcaccct ggaggtggag cccagcgaca ccatcgagaa       420
     cgtcaaggcc aagatccagg ataaggaggg catccccccc gaccagcaga ggctcatctt       480
     tgcaggcaag cagctggagg atgggcgcac cctgtctgac tacaacatcc agaaggagtc       540
     cactctgcac ctggttctgc gtctcagagg cgggatgcag attttcgtga agaccctgac       600
     cggcaagacc attaccctgg aggtggagcc cagcgacacc atcgagaatg tgaaggccaa       660
     gatccaggat aaggagggca tcccccccga ccagcagagg ttcatctttg caggcaagca       720
     gctggaggat gggcgcaccc tgtctgatta caacatccag aaggagtcca ctctgcacct       780
     ggttctgcgt ctcagaggtg ggatgcagat tttcgtgaag accctgaccg gcaagaccat       840
     caccctggag gtggagccca gcgacaccat cgagaatgtg aaggccaaga tccaggataa       900
     ggagggcatc ccccccgacc agcagaggct catctttgca ggcaagcagc tggaagatgg       960
     ccgcactctt tctgattaca acatccagaa agagtcgacc ctgcacctgg tgctccgtct      1020
     caggggtggc tgttagcttt tcagtcttgt ctttgtaatg tccagtgatg gcattactct      1080
     gcactccagc cattagcccc aatttaagtt tagaaattac cagtttcagt aatagctgaa      1140
     cctgttcaaa atgttaa                                                     1157
//

If you have problems or comments...

PBIL Back to PBIL home page