(data stored in ACNUC31108 zone)

EMBL: AF508304

ID   AF508304; SV 1; linear; mRNA; STD; HUM; 682 BP.
XX
AC   AF508304;
XX
DT   27-MAY-2002 (Rel. 71, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Homo sapiens lysosome-associated membrane protein-3 variant mRNA, complete
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-682
RA   Ancans J., Suzuki I., Thody A.J.;
RT   "Melanocyte variant of lysosome-associated membrane protein-3 (LAMP3; also
RT   CD63 and melanoma associated antigen ME419) mRNA";
RL   Unpublished.
XX
RN   [2]
RP   1-682
RA   Ancans J., Suzuki I., Thody A.J.;
RT   ;
RL   Submitted (01-MAY-2002) to the INSDC.
RL   Biomedical Sciences, University of Bradford, Richmond Rd., Bradford BD7
RL   1DP, UK
XX
DR   MD5; f777a992c3fa5cc61822004459e26b94.
DR   Ensembl-Gn; ENSG00000135404; homo_sapiens.
DR   Ensembl-Tr; ENST00000257857; homo_sapiens.
DR   Ensembl-Tr; ENST00000420846; homo_sapiens.
DR   Ensembl-Tr; ENST00000546939; homo_sapiens.
DR   Ensembl-Tr; ENST00000549117; homo_sapiens.
DR   Ensembl-Tr; ENST00000550776; homo_sapiens.
DR   Ensembl-Tr; ENST00000552692; homo_sapiens.
DR   Ensembl-Tr; ENST00000552754; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..682
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /cell_type="melanocytes"
FT                   /tissue_type="skin; epidermis"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        9..656
FT                   /codon_start=1
FT                   /product="lysosome-associated membrane protein-3 variant"
FT                   /note="LAMP-3; CD63; ME491"
FT                   /db_xref="GOA:P08962"
FT                   /db_xref="H-InvDB:HIT000081011.12"
FT                   /db_xref="HGNC:HGNC:1692"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="InterPro:IPR018503"
FT                   /db_xref="InterPro:IPR042028"
FT                   /db_xref="UniProtKB/Swiss-Prot:P08962"
FT                   /protein_id="AAM34259.1"
FT                   /translation="MAVEGGMKCVKFLLYVLLLAFCGATPGSLLPVVIIAVGVFLFLVA
FT                   FVGCCGACKENYCLMITFAIFLSLIMLVEVAAAIAGYVFRDKVMSEFNNNFRQQMENYP
FT                   KNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAI
FT                   HKEGCVEKIGGWLRKNVLVVAAAALGIAFVEVLGIVFACCLVKSIRSGYEVM"
XX
SQ   Sequence 682 BP; 139 A; 146 C; 206 G; 191 T; 0 other;
     cggcagccat ggcggtggaa ggaggaatga aatgtgtgaa gttcttgctc tacgtcctcc        60
     tgctggcctt ttgcggggct acccctggct ctctgttgcc agtggtcatc atcgcagtgg       120
     gtgtcttcct cttcctggtg gcttttgtgg gctgctgcgg ggcctgcaag gagaactatt       180
     gtcttatgat cacgtttgcc atctttctgt ctcttatcat gttggtggag gtggccgcag       240
     ccattgctgg ctatgtgttt agagataagg tgatgtcaga gtttaataac aacttccggc       300
     agcagatgga gaattacccg aaaaacaacc acactgcttc gatcctggac aggatgcagg       360
     cagattttaa gtgctgtggg gctgctaact acacagattg ggagaaaatc ccttccatgt       420
     cgaagaaccg agtccccgac tcctgctgca ttaatgttac tgtgggctgt gggattaatt       480
     tcaacgagaa ggcgatccat aaggagggct gtgtggagaa gattgggggc tggctgagga       540
     aaaatgtgct ggtggtagct gcagcagccc ttggaattgc ttttgtcgag gttttgggaa       600
     ttgtctttgc ctgctgcctc gtgaagagta tcagaagtgg ctacgaggtg atgtaggggt       660
     ctggtctcct cagcctcctc at                                                682
//

If you have problems or comments...

PBIL Back to PBIL home page