(data stored in ACNUC9552 zone)

EMBL: AF512835

ID   AF512835; SV 1; linear; mRNA; STD; ROD; 711 BP.
XX
AC   AF512835;
XX
DT   03-JUN-2003 (Rel. 76, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Rattus norvegicus Bcl2-like protein mRNA, complete cds.
XX
KW   .
XX
OS   Rattus norvegicus (Norway rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Rattus.
XX
RN   [1]
RP   1-711
RA   Tanaka T., Nangaku M.;
RT   "Rat Bcl2-like protein";
RL   Unpublished.
XX
RN   [2]
RP   1-711
RA   Tanaka T., Nangaku M.;
RT   ;
RL   Submitted (17-MAY-2002) to the INSDC.
RL   Division of Nephrology and Endocrinology, University of Tokyo, 7-3-1 Hongo
RL   Bunkyo-ku, Tokyo 113-0033, Japan
XX
DR   MD5; 3665b249f5c8b9dcc2b8e8a076fbde12.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..711
FT                   /organism="Rattus norvegicus"
FT                   /strain="Wistar"
FT                   /mol_type="mRNA"
FT                   /cell_line="temperature-sensitive SV40 immortalized
FT                   proximal tubule cell line"
FT                   /db_xref="taxon:10116"
FT   CDS_pept        1..711
FT                   /codon_start=1
FT                   /product="Bcl2-like protein"
FT                   /db_xref="GOA:Q7TSN8"
FT                   /db_xref="InterPro:IPR002475"
FT                   /db_xref="InterPro:IPR003093"
FT                   /db_xref="InterPro:IPR004725"
FT                   /db_xref="InterPro:IPR013278"
FT                   /db_xref="InterPro:IPR020717"
FT                   /db_xref="InterPro:IPR020726"
FT                   /db_xref="InterPro:IPR020728"
FT                   /db_xref="InterPro:IPR020731"
FT                   /db_xref="InterPro:IPR026298"
FT                   /db_xref="InterPro:IPR036834"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TSN8"
FT                   /protein_id="AAP47159.1"
FT                   /translation="MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDADAAPLGAAPT
FT                   PGIFSFQPESNPMPAVHRDMAARTSPLRPLVATAGPALSPVPPVVHLTLRRAGDDFSRR
FT                   YRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREM
FT                   SPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLAL
FT                   VGACITLGAYLGHK"
XX
SQ   Sequence 711 BP; 126 A; 208 C; 225 G; 152 T; 0 other;
     atggcgcaag ccgggagaac agggtatgat aaccgggaga tcgtgatgaa gtacatacat        60
     tataagctgt cacagagggg ctacgagtgg gatgctggag atgcggacgc ggcgcccctg       120
     ggggctgccc ccacccctgg catcttctcc ttccagcctg agagcaaccc aatgcccgct       180
     gtgcaccggg acatggctgc caggacgtct cctctcaggc ccctcgttgc caccgctggg       240
     cctgcgctca gccctgtgcc acctgtggtc catctgaccc tccgccgggc tggggatgac       300
     ttctctcgtc gctaccgtcg tgacttcgca gagatgtcca gtcagctgca cctgacgccc       360
     ttcaccgcga ggggacgctt tgccacggtg gtggaggaac tcttcaggga tggggtgaac       420
     tgggggagga ttgtggcctt ctttgagttc ggtggggtca tgtgtgtgga gagcgtcaac       480
     agggagatgt cacccctggt ggacaacatc gccctgtgga tgactgagta cctgaaccgg       540
     catctgcaca cctggatcca ggataacgga ggctgggatg cctttgtgga actatatggc       600
     cccagcatgc gacctctgtt tgatttctcc tggctgtctc tgaagaccct gctcagcctg       660
     gccctggtcg gggcctgcat cactctgggt gcatacctgg gccacaagtg a                711
//

If you have problems or comments...

PBIL Back to PBIL home page