(data stored in ACNUC24361 zone)

EMBL: AF513019

ID   AF513019; SV 1; linear; mRNA; STD; HUM; 3179 BP.
XX
AC   AF513019;
XX
DT   04-JUN-2002 (Rel. 72, Created)
DT   21-OCT-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Homo sapiens zinc finger protein 323 (ZNF323) mRNA, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3179
RX   DOI; 10.1016/S0006-291X(02)00772-6.
RX   PUBMED; 12147252.
RA   Pi H., Li Y., Zhu C., Zhou L., Luo K., Yuan W., Yi Z., Wang Y., Wu X.,
RA   Liu M.;
RT   "A novel human SCAN/(Cys)2(His)2 zinc-finger transcription factor ZNF323 in
RT   early human embryonic development";
RL   Biochem. Biophys. Res. Commun. 296(1):206-213(2002).
XX
RN   [2]
RP   1-3179
RA   Pi H., Li Y., Wu X.;
RT   ;
RL   Submitted (17-MAY-2002) to the INSDC.
RL   College of Life Sciences, Hunan Normal, 36 S. Nushan Road, Changsha, Hunan
RL   410081, China
XX
DR   MD5; f128cc621ea92f9418642348a5748655.
DR   Ensembl-Gn; ENSG00000235109; homo_sapiens.
DR   Ensembl-Tr; ENST00000344279; homo_sapiens.
DR   Ensembl-Tr; ENST00000396838; homo_sapiens.
DR   Ensembl-Tr; ENST00000414429; homo_sapiens.
DR   Ensembl-Tr; ENST00000439158; homo_sapiens.
DR   Ensembl-Tr; ENST00000446474; homo_sapiens.
DR   Ensembl-Tr; ENST00000611469; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3179
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p22.3-p22.1"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        527..1747
FT                   /codon_start=1
FT                   /gene="ZNF323"
FT                   /product="zinc finger protein 323"
FT                   /db_xref="GOA:Q96LW9"
FT                   /db_xref="H-InvDB:HIT000081089.14"
FT                   /db_xref="HGNC:HGNC:14097"
FT                   /db_xref="InterPro:IPR003309"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="InterPro:IPR038269"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q96LW9"
FT                   /protein_id="AAM47006.1"
FT                   /translation="MASTEEQYDLKIVKVEEDPIWDQETHLRGNNFSGQEASRQLFRQF
FT                   CYQETPGPREALSRLRELCHQWLRPEIHTKEQILELLVLEQFLTILPEELQAWVREHHP
FT                   ESGEEAVAVVEDLEQELSEPGNQAPDHEHGHSEVLLEDVEHLKVKQEPTDIQLQPMVTQ
FT                   LRYESFCLHQFQEQDGESIPENQELASKQEILKEMEHLGDSKLQRDVSLDSKYRETCKR
FT                   DSKAEKQQAHSTGERRHRCNECGKSFTKSSVLIEHQRIHTGEKPYECEECGKAFSRRSS
FT                   LNEHRRSHTGEKPYQCKECGKAFSASNGLTRHRRIHTGEKPYECKVCGKAFLLSSCLVQ
FT                   HQRIHTGEKRYQCRECGKAFIQNAGLFQHLRVHTGEKPYQCSQCSKLFSKRTLLKKHQK
FT                   IHTGERP"
XX
SQ   Sequence 3179 BP; 983 A; 665 C; 687 G; 844 T; 0 other;
     cagagagaga gagaaaaact gctgaccctg taagagagaa ctggccatct tgcagacaga        60
     cagagccccg agtgttcttt caactacctg ccacccatcc aacaactccc ctcggacctc       120
     agtatgggct ggaacctgac acttggcatg acagtgaccc caggcatcca aaccatgaca       180
     gttccatcag ctctccaaat gagagacaga gtctcactat gtcgcccagg cttgtcttga       240
     actcctggac tcaagagatc ctcccatctc ggcctctcaa agtgttggga ttacaggcgt       300
     gagctattac acctgactta agtctccatt ttcatatcta tactttggga ttccagaaga       360
     cagaggtttg agtgtaaaac acaaaataac aaaaccacaa caaaaacaac tctgtattct       420
     cgtccccacc attaccatct ctcctttgtg atgtcaaaga gaccagagga agtggacaga       480
     ctcggggaag aatagccaga gtaagccttc caaattaacc ccaggaatgg cttcaacaga       540
     ggaacagtac gatcttaaga ttgtgaaagt ggaggaagac cctatctggg accaagaaac       600
     ccaccttcga gggaacaact tttctggcca agaagcctcc cgacaacttt ttaggcagtt       660
     ttgttaccaa gagactcctg gtccccgaga agctctgagc cggctccgag aactctgtca       720
     tcagtggcta aggccagaaa tccacaccaa agagcaaatc ttggagctgc tggtgctgga       780
     gcaattcctg actatcctgc ctgaggagct ccaggcctgg gtgcgggagc accatccgga       840
     gagtggggag gaggctgtgg ctgtagttga agatctggaa caagagctta gtgagccagg       900
     gaaccaggct ccagaccatg aacatggaca ttctgaagtg ctcttggagg atgtggaaca       960
     tctgaaggtc aagcaggaac caacagacat acagcttcag cctatggtga cacagctcag      1020
     atatgaatct ttttgcctcc accaatttca agaacaagat ggtgaaagta tacctgagaa      1080
     ccaggagttg gcatcaaagc aagaaatctt aaaagaaatg gaacatttgg gggatagcaa      1140
     actccaaaga gatgtatctt tggattctaa gtacagagaa acttgtaaac gagacagcaa      1200
     ggcagaaaag cagcaggcac attccactgg agagagacgc cacaggtgca atgaatgtgg      1260
     gaaaagcttc actaagagtt cagtactcat tgagcaccag agaatccaca ctggggagaa      1320
     gccatatgaa tgtgaagaat gtgggaaggc cttcagccgg aggtcaagcc tgaatgaaca      1380
     tcggcggagc cacactggag agaaacccta tcaatgtaag gagtgtggga aagccttcag      1440
     tgccagcaat ggcctcactc gacacagaag aatccacaca ggggaaaaac catatgaatg      1500
     caaagtgtgt gggaaggctt tcctcctcag ctcatgcctt gttcagcatc agaggataca      1560
     cactggagag aagcgctatc agtgtcgtga gtgtggcaaa gccttcattc agaatgcagg      1620
     gcttttccag catctccgag tccacactgg tgagaaaccc tatcagtgca gtcagtgcag      1680
     taaactcttt agtaagcgga cacttcttaa gaaacatcag aaaatccaca ctggagagag      1740
     accataaggg tgatgagttt gggaaagcct tcagtcatca ttgcaacctt attaggcatt      1800
     ttagaatcca tactgttcca gcagaactgg actaattctg tggaccctca gacccctaaa      1860
     tggggccgtc ttggaaagta agattttcaa gtggcttatt ctgttcttat aaaatttatt      1920
     ttgtattgca ttgaaccact tgtctacaaa ccaggtgttg gtgtctcctg tgtggatgac      1980
     tgtgattgta gggggttgct gggtggcctt cttattccct agcctttggt ccatttctta      2040
     tgatttcctt taaaggcacc aaatcttatc tggaaataaa ttgttatgga ggggctgttt      2100
     ttgagcaata ctgcatattg aacaattcta aaagaccagt atctatgtat acttttaaaa      2160
     aaaagatttg ctaagatcaa aggatattca gaggtgcatc tttttctgta agagtgacat      2220
     tttaaacaaa tgtaaggttt tggggaataa gaatcgtcca cattcccaca ggaaatcatt      2280
     gctatggtct cccctaggaa tgtgatagat agcttctata attatgcagc attatccata      2340
     gtatgaaacc tgtagtttta atggtttaga aatctatgtc tcatttcata tctaactcat      2400
     gtttttgata cgaatcaata tatatgttga tatcatgagt taatatgagt ttgacatgaa      2460
     tcatcaacat agtatataca tatcaacata actatgttga tgattcatat caaattctca      2520
     atgcaggtca ttactgtaag ttttccattt ttgttacaaa taataagtaa gatgatactt      2580
     taaaatctct gttcttcaca aggtacctct ttaattcata gccttttatg tcagcattat      2640
     tcttcttttg ggggttggtc agcaactttg agtgccattg caagcagcat catttaagta      2700
     gttttataaa gaaaagaagt ctgatatctt gggcagcttg ctgcttactg gggagaccag      2760
     catgcttaga cacttattgc cagggttaaa catatgctct ggcaccaagt tcaaatcttt      2820
     cctccccatt tgtgagctgt gggactttag gcaagttatc taaatgctgc tatgctatag      2880
     tctccccacc tgtaaaacag aggatgatac caataccttc ctcatagggt acataagatt      2940
     aaataaatac aaacttgtac ttaaaatgta gctctcaata aatatgcatt atgatttaca      3000
     tacgaaataa tagcatttaa caaatgtagg tagaatttta agtatcatgt taaaattagg      3060
     atacgaaatg cctctgctga cattcttgtt actcttttct ccacagtcaa aacctgaatc      3120
     agaatatttc aaaagagagg aaataaaagt tcagcttaaa actgttctgc cctaaaaaa       3179
//

If you have problems or comments...

PBIL Back to PBIL home page