(data stored in ACNUC10243 zone)

EMBL: AF517524

ID   AF517524; SV 1; linear; mRNA; STD; HUM; 472 BP.
XX
AC   AF517524;
XX
DT   13-JUN-2002 (Rel. 72, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Homo sapiens BX1 mRNA, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-472
RA   Favier A.-L., Harsi C., Chroboczek W.;
RT   "Protein partner of head domain of the Ad41 short fiber";
RL   Unpublished.
XX
RN   [2]
RP   1-472
RA   Favier A.-L., Harsi C., Chroboczek W.;
RT   ;
RL   Submitted (31-MAY-2002) to the INSDC.
RL   Laboratoire de Biophysisque Moleculaire, Institut de Biologie
RL   Structurale-IBS, 41 avenue Jules Horowitz, Grenoble 38027, France
XX
DR   MD5; 63007efcd8e744e7631c82841ee45d15.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..472
FT                   /organism="Homo sapiens"
FT                   /chromosome="X"
FT                   /mol_type="mRNA"
FT                   /clone="HSF41-58"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        <1..192
FT                   /codon_start=1
FT                   /product="BX1"
FT                   /note="protein partner of Ad41 short fiber; similar to the
FT                   sequences of GenBank Accession Numbers Y16641 and AF069072"
FT                   /db_xref="H-InvDB:HIT000081125.14"
FT                   /db_xref="InterPro:IPR021662"
FT                   /db_xref="UniProtKB/TrEMBL:Q8NFG3"
FT                   /protein_id="AAM51824.1"
FT                   /translation="GNFGGGNYGGGGNYNDFGNYSGQQQSNYGPMKGGSFGGRSSGSPY
FT                   GGGYGSGGGSGGYGSRRF"
XX
SQ   Sequence 472 BP; 143 A; 70 C; 135 G; 124 T; 0 other;
     ggaaattttg gcggtggtaa ctatggtggt ggtgggaact ataatgattt tggaaattat        60
     agtggacaac agcaatcaaa ttatggaccc atgaaagggg gcagttttgg tggaagaagc       120
     tcgggcagtc cctatggtgg tggttatgga tctggtggtg gaagtggtgg atatggtagc       180
     agaaggttct aaaaacagca gaaaagggct acagttctta gcaggagaga gagcgaggag       240
     ttgtcaggaa agctgcaggt tactttgaga cagtcgtccc aaatgcatta gaggaactgt       300
     aaaaatctgc cacagaagga acgatgatcc atagtcagaa aagttactgc agcttaaaca       360
     ggaaaccctt cttgttcagg actgtcatag ccacagtttg caaaaagtgc agctattgat       420
     taatgcaatg tagtgtcaat tagatgtaca ttcctgaggt cttttatctg tt               472
//

If you have problems or comments...

PBIL Back to PBIL home page