(data stored in ACNUC21562 zone)

EMBL: AF518244

ID   AF518244; SV 1; linear; genomic DNA; STD; ROD; 738 BP.
XX
AC   AF518244;
XX
DT   09-AUG-2003 (Rel. 76, Created)
DT   28-AUG-2003 (Rel. 77, Last updated, Version 2)
XX
DE   Rattus norvegicus MRGB6 G protein-coupled receptor (Mrgb6) gene, partial
DE   cds.
XX
KW   .
XX
OS   Rattus norvegicus (Norway rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Rattus.
XX
RN   [1]
RP   1-738
RX   DOI; 10.1073/pnas.1732949100.
RX   PUBMED; 12909716.
RA   Zylka M.J., Dong X., Southwell A.L., Anderson D.J.;
RT   "Atypical expansion in mice of the sensory neuron-specific Mrg G
RT   protein-coupled receptor family";
RL   Proc. Natl. Acad. Sci. U.S.A. 100(17):10043-10048(2003).
XX
RN   [2]
RP   1-738
RA   Zylka M.J., Dong X., Southwell A.L., Anderson D.J.;
RT   ;
RL   Submitted (03-JUN-2002) to the INSDC.
RL   Division of Biology, 216-76, California Institute of Technology, 1201 E.
RL   California Blvd., Pasadena, CA 91125, USA
XX
DR   MD5; 47e98141cef8060b25bc98f169fe3ef5.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..738
FT                   /organism="Rattus norvegicus"
FT                   /strain="Sprague-Dawley"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10116"
FT   gene            <3..>738
FT                   /gene="Mrgb6"
FT   mRNA            <3..>738
FT                   /gene="Mrgb6"
FT                   /product="MRGB6 G protein-coupled receptor"
FT   CDS_pept        3..>738
FT                   /codon_start=1
FT                   /gene="Mrgb6"
FT                   /product="MRGB6 G protein-coupled receptor"
FT                   /db_xref="GOA:Q7TN43"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="InterPro:IPR026234"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TN43"
FT                   /protein_id="AAQ08316.1"
FT                   /translation="MDINISTLDIDIIELNGSNYTNTEICFVKIQVMSLLSLIICPVGM
FT                   VLNALVLWFLGFQMTRNAFSVYILNLAGADFFFLYSQFLFYILAIISYKYSISFRIPFL
FT                   FEVLAKVAYLSGLSILSTISIERCLCIMWPIWYRCQRPRHTSSVTCFLLWTLSLLFALL
FT                   EGAECGLLFNSFDQSRCLRFDLIFCAWSIVLFVVLCGSSLILLIRIFCGSQRIPVTRLY
FT                   VTIVLTVLFFLICCLPFGISWLI"
XX
SQ   Sequence 738 BP; 143 A; 179 C; 151 G; 265 T; 0 other;
     gcatggatat aaacatctca actctggata ttgacatcat agaactgaac ggaagcaact        60
     acactaatac tgagatatgt tttgtcaaga tccaagtcat gagtttactt tccctcatca       120
     tttgccctgt tgggatggtg ctaaatgcct tagtgctgtg gttcctgggc ttccagatga       180
     ccaggaatgc cttctctgtc tatatcctca acctggctgg ggctgacttt ttcttcctgt       240
     actctcagtt tttattttac attcttgcta tcatttccta caagtactcc atttctttcc       300
     ggatcccttt cctttttgaa gtgttggcaa aagttgctta tctttctggc ctgagcattc       360
     ttagtaccat cagcattgaa cgctgcctgt gtatcatgtg gcccatctgg tatcgctgcc       420
     aacgaccaag acacacatca tcggtcacct gtttcttgct ttggactttg tccttgttgt       480
     ttgctcttct ggagggggca gaatgtggcc tgctgtttaa cagttttgac cagtctcggt       540
     gtttgagatt tgatttaatc ttttgcgcat ggtcaattgt tttatttgtg gttctctgcg       600
     ggtccagcct catcctactt atcaggatct tctgtggctc ccagcggata cctgtgacca       660
     gactgtatgt gaccattgta ctcacagtgc tattcttcct gatctgctgt cttccctttg       720
     gaatctcctg gctcatcc                                                     738
//

If you have problems or comments...

PBIL Back to PBIL home page