(data stored in ACNUC31108 zone)

EMBL: AF525029

ID   AF525029; SV 1; linear; mRNA; STD; MAM; 1054 BP.
XX
AC   AF525029;
XX
DT   25-JUL-2002 (Rel. 72, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Sus scrofa transmembrane protein CD9 (CD9) mRNA, complete cds.
XX
KW   .
XX
OS   Sus scrofa (pig)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae; Sus.
XX
RN   [1]
RP   1-1054
RX   DOI; 10.1016/S0301-472X(02)00835-4.
RX   PUBMED; 12135680.
RA   Heinz M., Huang C.A., Emery D.W., Giovino M.A., LeGuern A.,
RA   Kurilla-Mahon B., Theodore P., Arn J.S., Sykes M., Mulligan R.C.,
RA   Down J.D., Sachs D.H., Goodell M.A.;
RT   "Use of CD9 expression to enrich for porcine hematopoietic progenitors";
RL   Exp. Hematol. 30(7):809-815(2002).
XX
RN   [2]
RP   1-1054
RA   Heinz M., Goodell M.A.;
RT   ;
RL   Submitted (25-JUN-2002) to the INSDC.
RL   Center for Cell and Gene Therapy, Baylor College of Medicine, One Baylor
RL   Plaza, BCM505, Houston, TX 77030, USA
XX
DR   MD5; c3c36b876213faf0b39ec4bd732e9530.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1054
FT                   /organism="Sus scrofa"
FT                   /mol_type="mRNA"
FT                   /note="breed: miniature swine"
FT                   /db_xref="taxon:9823"
FT   CDS_pept        132..812
FT                   /codon_start=1
FT                   /gene="CD9"
FT                   /product="transmembrane protein CD9"
FT                   /note="member of the TM4 or tetraspanin family of small
FT                   transmembrane proteins; 4 putative membrane-spanning
FT                   regions; variable region between TM3 and TM4"
FT                   /db_xref="GOA:Q8MJ48"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="InterPro:IPR018503"
FT                   /db_xref="InterPro:IPR042055"
FT                   /db_xref="UniProtKB/TrEMBL:Q8MJ48"
FT                   /protein_id="AAM81376.1"
FT                   /translation="MPVKGGTKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIF
FT                   EQENNNSSFYTGVYILIGAGALMMVVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIPA
FT                   AIWGYSHKDQVIKEVQDFYRDTYNKLKGKDDPQRETLKAIHYALDCCGLMGGVEQLLAD
FT                   ICPQKDVLSSLPMKPCPEAIKEVFQNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRS
FT                   REMV"
FT   misc_feature    168..200
FT                   /gene="CD9"
FT                   /note="transmembrane region 1; transmembrane-region site"
FT   misc_feature    309..371
FT                   /gene="CD9"
FT                   /note="transmembrane region 2; transmembrane-region site"
FT   misc_feature    387..464
FT                   /gene="CD9"
FT                   /note="transmembrane region 3; transmembrane-region site"
FT   misc_feature    702..782
FT                   /gene="CD9"
FT                   /note="transmembrane region 4; transmembrane-region site"
XX
SQ   Sequence 1054 BP; 229 A; 269 C; 268 G; 288 T; 0 other;
     gaattcggcg cgccagatat cacacgtgcc aaggggctgg ctcacttcgc tccgcagccc        60
     agtcccgtgt gtctcggccg caagcgccct cgtcccgcac ccgtccggcc caggccagtc       120
     tagcccgcac catgccggtc aaaggaggca ctaagtgtat caaatacttg ctcttcggat       180
     ttaacttcat cttctggctc gctgggattg cggtccttgc cattggacta tggctccgat       240
     ttgactctca gaccaagagc atcttcgagc aagaaaataa taactctagc ttctacacag       300
     gagtttatat tctcattgga gccggcgccc tcatgatggt ggtgggcttc ctgggctgct       360
     gcggggccgt gcaggagtcc cagtgcatgc tgggcttgtt ctttggcttc ctcttggtga       420
     tatttgccat tgaaataccc gcggccatct ggggatattc ccacaaggat caggtgatca       480
     aagaagtcca ggatttctac agggacactt acaacaagct gaagggcaag gacgaccccc       540
     agcgggagac tctgaaagcc atccactatg cgctggactg ctgtggttta atggggggag       600
     tggaacaact tctggcagac atctgccccc aaaaggacgt actctcaagc ctcccaatga       660
     agccctgccc tgaggccatc aaagaggtct tccaaaacaa gttccacatc attggcgccg       720
     tgggcattgg gatcgccgtg gtgatgattt tcggcatgat cttcagcatg atcctgtgct       780
     gtgccatccg tcggagccga gagatggtct agagtcagcc tcgcagccct gagcaggaaa       840
     gtccacccct gaagactatt ggtcatcttc tcggggtcct gtttgtattt cttttggttt       900
     ctttgccact aactttagta ttcagtctgc atttctaaac aaaacaaaaa aaaagttatt       960
     ctatgtttat gtttgtaatg ctttattcaa tattgatatt tgtagttaag gggtttgggt      1020
     ttgctcgggt ttatatttgt ttggtcattt gttt                                  1054
//

If you have problems or comments...

PBIL Back to PBIL home page