(data stored in ACNUC16935 zone)

EMBL: AF528710

ID   AF528710; SV 1; linear; genomic DNA; STD; PLN; 786 BP.
XX
AC   AF528710;
XX
DT   24-FEB-2003 (Rel. 74, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   Arabidopsis thaliana ecotype Ita-0 putative polyubiquitin (UBQ13) gene,
DE   partial cds.
XX
KW   .
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliophyta; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-786
RX   PUBMED; 12663546.
RA   Shepard K.A., Purugganan M.D.;
RT   "Molecular population genetics of the Arabidopsis CLAVATA2 region. The
RT   genomic scale of variation and selection in a selfing species";
RL   Genetics 163(3):1083-1095(2003).
XX
RN   [2]
RP   1-786
RA   Shepard K.A., Purugganan M.D.;
RT   ;
RL   Submitted (10-JUL-2002) to the INSDC.
RL   Genetics, North Carolina State University, Campus Box 7614, Raleigh, NC
RL   27695-7614, USA
XX
DR   MD5; 3ab1c6382734aa14caa2a1bb5aeb7081.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..786
FT                   /organism="Arabidopsis thaliana"
FT                   /mol_type="genomic DNA"
FT                   /note="ABRC accession CS1244 ecotype: Ita-0"
FT                   /db_xref="taxon:3702"
FT   mRNA            <28..>780
FT                   /gene="UBQ13"
FT                   /product="putative polyubiquitin"
FT   CDS_pept        <28..780
FT                   /codon_start=1
FT                   /gene="UBQ13"
FT                   /product="putative polyubiquitin"
FT                   /note="includes At1g65345 and At1g65350; this ecotype does
FT                   not contain the mitochondrial DNA insertion observed in
FT                   Col-0; possible pseudogene"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/TrEMBL:Q6KFS0"
FT                   /protein_id="AAO43307.1"
FT                   /translation="ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDN
FT                   VKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTL
FT                   TGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTL
FT                   HLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQL
FT                   EDGRTLADYNIQKESTLHLVLRLRGGSF"
XX
SQ   Sequence 786 BP; 225 A; 168 C; 193 G; 200 T; 0 other;
     tggacctcaa ctttttgcta tgagtaggct gattacaata tccagaagga atcaacactc        60
     catttggttc tcaggttaag aggtggtatg cagatttttg tcaagacttt gacaggcaaa       120
     accatcactt tggaggttga aagttctgat actattgaca atgttaaagc taagatccag       180
     gataaggaag gaatccctcc ggatcagcag aggcttatct ttgccggtaa gcagcttgaa       240
     gacggtcgca cactcgctga ttacaacatc caaaaggagt ccaccctcca tttggtgctt       300
     cgtctcagag gtggtatgca gatatttgtg aagaccctca ctggaaagac aatcactttg       360
     gaggttgaga gctcagacac catcgataac gtgaaggcta agattcagga caaggaaggt       420
     atcccaccag accaacagag actcatattc gctggtaaac agcttgagga tggtcgcaca       480
     cttgctgatt acaatatcca gaaggagtct acgcttcacc ttgtgttgcg tcttcgtggt       540
     ggtatgcaaa tctttgtgaa aactttgaca ggcaagacaa ttaccttgga ggttgagagc       600
     tcagacacaa tcgataacgt caaggctaag atacaggaca aggaggggat tccaccagac       660
     caacagagac tcatcttcgc tgggaaacag ctcgaggatg gtcggacttt ggctgattac       720
     aacatccaga aggaatcgac tcttcacttg gttcttcgtc ttcgtggtgg aagcttctga       780
     gctttg                                                                  786
//

If you have problems or comments...

PBIL Back to PBIL home page