(data stored in ACNUC19913 zone)

EMBL: AF532184

ID   AF532184; SV 1; linear; mRNA; STD; ROD; 1341 BP.
XX
AC   AF532184;
XX
DT   21-AUG-2002 (Rel. 72, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Rattus norvegicus coagulation factor VII mRNA, complete cds.
XX
KW   .
XX
OS   Rattus norvegicus (Norway rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Rattus.
XX
RN   [1]
RP   1-1341
RA   Murphy K., Ramaker M.;
RT   "Nucleotide sequence of the cDNA encoding rat coagulation factor VII";
RL   Unpublished.
XX
RN   [2]
RP   1-1341
RA   Murphy K., Ramaker M.;
RT   ;
RL   Submitted (24-JUL-2002) to the INSDC.
RL   Biotechnology, Bristol-Myers Squibb, P.O. Box 80336, Wilmingtion, DE
RL   19880-0336, USA
XX
DR   MD5; 477bee19e203d39537f0c422bfbeb6b7.
DR   Ensembl-Gn; ENSRNOG00000032737; rattus_norvegicus.
DR   Ensembl-Tr; ENSRNOT00000037806; rattus_norvegicus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1341
FT                   /organism="Rattus norvegicus"
FT                   /strain="Sprague-Dawley"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10116"
FT   CDS_pept        1..1341
FT                   /codon_start=1
FT                   /product="coagulation factor VII"
FT                   /db_xref="GOA:Q8K3U6"
FT                   /db_xref="InterPro:IPR000152"
FT                   /db_xref="InterPro:IPR000294"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR001314"
FT                   /db_xref="InterPro:IPR001881"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR012224"
FT                   /db_xref="InterPro:IPR013032"
FT                   /db_xref="InterPro:IPR017857"
FT                   /db_xref="InterPro:IPR018097"
FT                   /db_xref="InterPro:IPR018114"
FT                   /db_xref="InterPro:IPR033116"
FT                   /db_xref="InterPro:IPR033190"
FT                   /db_xref="InterPro:IPR035972"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8K3U6"
FT                   /protein_id="AAM95967.1"
FT                   /translation="MVPQTHGLLLLYFLLQLQGPLGAVVFITQEEAHGVLHRQRRANSL
FT                   LEELWSSSLERECNEERCSFEEAREIFKSPERTKQFWTIYSDGDQCASNPCQNGGTCQD
FT                   HLKSYVCFCPLDFEGRNCEKNKNEQLICANENGDCDQYCRDHVGTKRTCSCHEDYVLQP
FT                   DEVSCKPKVEYPCGRIPVVEKRNFSRPQGRIVGGYVCPKGECPWQAVLKFNEALLCGAV
FT                   LLDTRWIVTAAHCFDKFGKLVNITVVLGEHDFSEKEGTEQVRLVEQVIMPNKYTRGRTD
FT                   HDIALVRLHRPVTFTDYVVPLCLPERAFSENTLASIRFSRVSGWGQLLDRGATALELMV
FT                   IEVPRLMTQDCLEHAKHSANTPRITENMFCAGYMDGTKDACKGDSGGPHATHYHGTWYL
FT                   TGVVSWGEGCAAIGHIGVYTRVSQYIDWLVKYMDSKLRVGISRVSLL"
XX
SQ   Sequence 1341 BP; 318 A; 360 C; 392 G; 271 T; 0 other;
     atggttccac agactcacgg actgctgctt ctctactttc tgctccagct ccagggaccc        60
     ctaggggctg tggttttcat aacccaggag gaagcacacg gtgtcctaca caggcaaagg       120
     cgtgccaact cactcctaga ggagctttgg tctagctcct tggagaggga gtgcaatgaa       180
     gagcggtgct cctttgagga ggcccgagag atcttcaaga gccctgagag aaccaagcag       240
     ttctggacta tttacagcga tggcgaccag tgtgcctcga atccatgtca gaacgggggt       300
     acctgccagg atcacctcaa gtcttatgtc tgcttctgcc ccctagactt tgagggccgg       360
     aactgtgaga aaaacaagaa tgagcagctg atctgtgcaa atgaaaatgg tgactgtgac       420
     cagtactgca gggaccacgt agggaccaag cgtacctgta gctgtcacga ggactacgtg       480
     ctgcagccag atgaggtgtc ctgcaaacca aaagttgagt acccatgcgg gagaatacct       540
     gttgtagaaa aaagaaactt cagcagaccc caaggccgga ttgtgggagg ctatgtgtgc       600
     cccaaagggg agtgcccatg gcaggctgtg ctgaaattca atgaggcatt gctgtgtggg       660
     gccgtcctgc tggacaccag atggatagta actgcagccc actgcttcga taaattcggg       720
     aaattggtaa acatcacagt ggtgttgggt gaacacgact tcagtgagaa ggaggggact       780
     gagcaagtac ggctggtgga acaggtcatc atgcccaaca agtacacccg cggcaggact       840
     gaccatgaca tcgccctggt ccgccttcac cggcctgtaa ccttcactga ctacgtggta       900
     cctctgtgtc tgcctgaacg ggccttctcc gagaacaccc tagccagcat ccgcttctcg       960
     agggtcagcg gctggggcca gctactggac cgtggtgcca cagctctgga gctcatggtc      1020
     atcgaggtgc cccggctgat gacccaggac tgcctggagc atgccaaaca cagtgctaac      1080
     acccccagaa tcacggagaa catgttctgc gccggctaca tggacggcac caaggacgcc      1140
     tgcaagggtg acagtggagg cccacacgcc acccactacc atggcacttg gtatctgaca      1200
     ggtgtggtca gctgggggga gggctgtgca gctatcggcc acatcggggt gtacaccagg      1260
     gtctcccagt acatagactg gctggtcaaa tacatggact ccaagctccg ggttgggatt      1320
     tctcgagtct ccctactgta g                                                1341
//

If you have problems or comments...

PBIL Back to PBIL home page