(data stored in ACNUC9306 zone)

EMBL: AF537266

ID   AF537266; SV 1; linear; mRNA; STD; MAM; 2361 BP.
XX
AC   AF537266;
XX
DT   10-SEP-2002 (Rel. 73, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Oryctolagus cuniculus ezrin mRNA, complete cds.
XX
KW   .
XX
OS   Oryctolagus cuniculus (rabbit)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Lagomorpha; Leporidae; Oryctolagus.
XX
RN   [1]
RP   1-2361
RA   Goldenring J.R.;
RT   ;
RL   Submitted (11-AUG-2002) to the INSDC.
RL   Surgery, Vanderbilt University School of Medicine, 465 21st Street,
RL   Nashville, TN 37232, USA
XX
DR   MD5; 187bc7a9fa92b53e56fa71e90c2e4b3d.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2361
FT                   /organism="Oryctolagus cuniculus"
FT                   /mol_type="mRNA"
FT                   /cell_type="parietal cell"
FT                   /note="breed: New Zealand White"
FT                   /db_xref="taxon:9986"
FT   CDS_pept        1..1761
FT                   /codon_start=1
FT                   /product="ezrin"
FT                   /note="actin-binding protein; member of ERM family"
FT                   /db_xref="GOA:Q8HZQ5"
FT                   /db_xref="InterPro:IPR000299"
FT                   /db_xref="InterPro:IPR000798"
FT                   /db_xref="InterPro:IPR008954"
FT                   /db_xref="InterPro:IPR011174"
FT                   /db_xref="InterPro:IPR011259"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR014352"
FT                   /db_xref="InterPro:IPR018979"
FT                   /db_xref="InterPro:IPR018980"
FT                   /db_xref="InterPro:IPR019747"
FT                   /db_xref="InterPro:IPR019748"
FT                   /db_xref="InterPro:IPR019749"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR035963"
FT                   /db_xref="InterPro:IPR041789"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8HZQ5"
FT                   /protein_id="AAN06818.1"
FT                   /translation="MPKPINVRVTTMDAELEFAVQPNTTGKQLFDQVVKTIGLREVWYF
FT                   GLQYVDNKGFPTWLKLDKKVSAQEVRKENPVQFKFRAKFYPEDVSEELIQDITQKLFFL
FT                   QVKEGILSDEIYCPPETAVLLGSYAVQAKFGDYSKEAHKAGYLSSERLIPQRVMDQHKL
FT                   SRDQWEDRIQVWHAEHRGMLKDSAMLEYLKIAQDLEMYGINYFEIKNKKGTDLWLGVDA
FT                   LGLNIYEKNDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRIL
FT                   QLCMGNHELYMRRRKPDTIEVQQMKAQAREEKHQKQLERQQLESEKKRREAVEQEKEQM
FT                   LREKEELMMRLQDYEQKTKKAEKELSDQIQRALQLEDERKRAQEESERLEADRVAALRA
FT                   KEELERQAADQIKSQEQLAAELAEYTAKIALLEEARRRKESEVEEWQHRAREAQDDLVK
FT                   TKEELHLVMTAPPPPPPPMYEPVSYHVQEHLHEEGAESLGYSAELSSEGILDDRHEEKR
FT                   ITEAEKNERVQRQLLTLSNELSQARDENKRTHNDIIHNENLRQGRDKYKTLRQIRQGNT
FT                   KQRIDEFEAM"
XX
SQ   Sequence 2361 BP; 559 A; 681 C; 746 G; 375 T; 0 other;
     atgccgaaac caatcaatgt ccgagttacc accatggatg cagagctgga gtttgccgtc        60
     cagccaaata caaccggaaa acagctgttc gatcaggtgg tgaagaccat cggcctccgg       120
     gaagtctggt actttggcct gcagtacgtg gataataaag ggtttcccac ctggctgaaa       180
     cttgataaaa aggtctccgc ccaggaggtc cggaaggaga accccgtcca gttcaagttc       240
     agggccaagt tctacccgga ggacgtgtcc gaggagctca tccaggacat cacgcagaag       300
     ctgttcttcc tgcaagtgaa ggaaggcatc ctcagtgacg agatctactg cccgcccgag       360
     acggccgtgc tgctcggctc ctacgccgtg caggccaagt tcggagacta cagcaaggag       420
     gcgcacaagg ccggctacct cagctctgag cggctgatcc cgcagagggt catggaccag       480
     cacaagctct ccagggacca gtgggaggac cggatccagg tgtggcacgc ggagcaccgc       540
     gggatgctca aggacagcgc tatgctggag tacctgaaga tcgcccagga cctggaaatg       600
     tatggcatta actacttcga gatcaaaaac aagaagggga cggacctctg gctcggcgtc       660
     gacgcactcg ggctgaacat ctacgagaag aacgataagt tgaccccaaa gatcggcttt       720
     ccttggagtg aaatcaggaa catctctttc aatgacaaaa agtttgtcat taagcccatc       780
     gataagaagg cacctgactt cgtgttctac gccccccgcc tgaggatcaa caagcggatc       840
     ctgcagctct gcatgggcaa ccacgagctg tacatgcgcc gccggaagcc ggacaccatc       900
     gaggtccagc agatgaaggc gcaggcgcgc gaggagaagc accagaagca gctggagcgg       960
     caacagctgg agtcggagaa gaagaggagg gaggccgtgg agcaggagaa ggagcagatg      1020
     ttgcgggaga aggaggagct gatgatgcgg ctgcaggact acgagcagaa gaccaagaag      1080
     gcggagaaag agctctccga ccagatccag agagccctgc agctggagga cgagaggaag      1140
     cgcgcccagg aggagtccga gcgcctggag gcggaccgcg tggccgcgct gcgggccaag      1200
     gaggagctgg agaggcaggc ggcggaccag ataaagagcc aagagcagct ggccgcagag      1260
     ctcgccgaat acaccgccaa gattgccctg ctggaggagg cgcggcggcg caaggagagc      1320
     gaggtggaag aatggcagca ccgggcccgg gaggcccagg acgacctggt gaagaccaag      1380
     gaggagctgc acctggtgat gacggcgccc ccgcccccgc cgccccccat gtatgagccg      1440
     gtgagttacc acgtccagga gcacctgcac gaggagggcg cggagtccct gggctacagc      1500
     gccgagctgt ccagcgaggg catcctggac gaccgccacg aggagaagcg catcaccgag      1560
     gccgagaaga acgagcgcgt gcagcgacag ctgttgaccc tcagcaacga gctgtcccag      1620
     gccagagacg agaacaagcg gacgcacaac gacatcatcc acaacgagaa cctgaggcag      1680
     ggccgcgaca agtacaagac gctgcggcag atccggcagg gcaacaccaa gcagcgcatc      1740
     gacgagttcg aggccatgtg aagccccggc gcgcccgcgc cctcctgctg tctgcagatc      1800
     cagtgccttc acgcgggggc caggcgcccg caggagtcgc ctgggccggg ccccgggcca      1860
     ggcgcccttg ttcactgtcc ccactgtctc ctagtgccaa gcgggcctcg cggggttggg      1920
     tgtgggatgg ctccctgccc ccgcagaggc cgcgtgccag gctcggcgcc agccggcgag      1980
     ccaggagggc aggattccgc ctccttaggg acacctcgca ccttcgcccg tgccatactc      2040
     tctctgtatt tgaaatgagc tcagattgat tgatttgttc ctgatttcta tgaaggatcc      2100
     acctctgcag tccgcgggtg aacaatcgac tcggagtcgg tgtccctgat gtccctgcgc      2160
     ggctgcggct ggcagaactg caggggccac tcccagtgga cactcacggt taactctctc      2220
     tgcttcacag accaccttgt gggacttgtt cgtgagaacc atcacttaac gcatcctatt      2280
     tatgtgtgcg acaatggaat tggtgacatt atttcaaaaa aggaaaccct ctgtatattt      2340
     tgttaccttt taccgaataa t                                                2361
//

If you have problems or comments...

PBIL Back to PBIL home page