(data stored in ACNUC27125 zone)

EMBL: AF541961

ID   AF541961; SV 1; linear; mRNA; STD; MAM; 3232 BP.
XX
AC   AF541961;
XX
DT   26-SEP-2002 (Rel. 73, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   Oryctolagus cuniculus calcineurin A beta mRNA, complete cds.
XX
KW   .
XX
OS   Oryctolagus cuniculus (rabbit)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Lagomorpha; Leporidae; Oryctolagus.
XX
RN   [1]
RP   1-3232
RX   PUBMED; 12419772.
RA   Sun L., Moonga B.S., Lu M., Zaidi N., Iqbal J., Blair H.C., Epstein S.,
RA   Abe E., Troen B.R., Huang C.L.H., Zaidi M.;
RT   "Molecular cloning, expression, and function of osteoclastic calcineurin
RT   Aalpha";
RL   Am. J. Physiol. Renal Physiol. 284(3):F575-F583(2003).
XX
RN   [2]
RP   1-3232
RA   Sun L., Zaidi M.;
RT   ;
RL   Submitted (28-AUG-2002) to the INSDC.
RL   Endocrinology/Medicine, Mount Sinai School of Medicine, One Gustave L. Levy
RL   Place, New York, NY 10029, USA
XX
DR   MD5; 36080c43d642cf521209227377ddc789.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3232
FT                   /organism="Oryctolagus cuniculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9986"
FT   CDS_pept        37..1611
FT                   /codon_start=1
FT                   /product="calcineurin A beta"
FT                   /db_xref="GOA:Q8HZM9"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041751"
FT                   /db_xref="UniProtKB/TrEMBL:Q8HZM9"
FT                   /protein_id="AAN23153.1"
FT                   /translation="MAAPEPARAAPPPPPPPPPPPGADRVVKAVPFPPTHRLTSEEVFD
FT                   VDGIPRVDVLKNHLVKEGRVDEEIALRIINEGAAILRREKTMIEVEAPITVCGDIHGQF
FT                   FDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWVLKILYPSTLFLLRGNHECR
FT                   HLTEYFTFKQECKIKYSERVYEACMEAFDSLPLAALLNQQFLCVHGGLSPEIHTLDDIR
FT                   RLDRFKEPPAFGPMCDLLWSDPSEDFGNEKSQEHFSHNTVRGCSYFYNYPAVCEFLQNN
FT                   NLLSIIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNI
FT                   RQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLSICSDDELMTEGEDQFDGSAA
FT                   ARKEIIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLAGGRQTLQSATV
FT                   EAIEAEKAIRGFSPPHRICSFEEAKGLDRINERMPPRKDAVQQDGFNSLNTAHATENHG
FT                   TGNHNAQ"
XX
SQ   Sequence 3232 BP; 953 A; 613 C; 687 G; 979 T; 0 other;
     ggcacgagca acgcctagcc gagccccggg cccagcatgg ccgccccgga gccggcgcgg        60
     gccgcaccgc ccccaccccc gcccccgccg ccccctcccg gggctgaccg cgtcgtcaaa       120
     gctgtccctt tccctccaac acatcgtttg acatctgaag aagtatttga tgtggacggg       180
     atacccaggg ttgatgtttt gaagaaccac ttagtaaaag aaggtcgagt agatgaagaa       240
     attgcactta gaattatcaa tgagggtgct gccatccttc ggagagagaa aaccatgata       300
     gaagtagaag ctccaattac agtgtgtggt gatatccatg gccaattttt tgatctgatg       360
     aaactgtttg aagtaggagg atcacctgct aatacacgat acctttttct tggtgattat       420
     gtggacagag gttactttag tatagagtgt gtcttatatt tatgggtctt gaagattctg       480
     tacccaagca cattatttct tctgagagga aaccatgaat gcagacacct tactgaatat       540
     tttaccttta aacaggaatg taaaattaaa tattcagaaa gagtctatga agcttgtatg       600
     gaagcttttg atagcctgcc tcttgctgca cttttaaacc aacagtttct ctgtgttcat       660
     ggtggacttt cacccgaaat acacacactg gatgatatta ggagattaga tagattcaaa       720
     gagccacctg catttggacc aatgtgtgac ttgctatggt ccgatccttc tgaagatttt       780
     ggaaatgaaa aatcacagga acattttagt cacaatacag ttcgaggatg ttcttatttt       840
     tataactatc cagcagtgtg tgaatttttg caaaacaata atttgttatc gattattaga       900
     gctcatgaag ctcaagatgc aggctataga atgtacagaa aaagtcaaac tacagggttc       960
     ccttcattaa taacaatttt ttcggcccct aattacttag atgtctacaa taataaagct      1020
     gctgtattaa agtatgaaaa taatgtgatg aatattcgac agtttaactg ttctccacat      1080
     ccttactggt tacccaattt tatggatgtc ttcacatggt ctttaccatt tgttggggaa      1140
     aaagtgaccg aaatgttggt aaatgtcttg agtatttgct ctgatgatga actaatgact      1200
     gaaggtgaag accaatttga tggttcagct gcagcccgga aagaaatcat aagaaacaaa      1260
     attcgagcaa ttggcaagat ggcaagagtc ttctctgttc tcagggagga gagtgaaagt      1320
     gtgctgacac tcaagggcct gactcccaca gggatgttgc ctagtggagt gttggctgga      1380
     ggacggcaga ccctacaaag tgccacagtt gaggctattg aggctgaaaa agcaatacga      1440
     ggattctctc caccacatag aatctgcagt tttgaagagg caaagggttt ggataggatc      1500
     aatgagagaa tgccaccccg gaaagatgct gtacagcaag atggtttcaa ttctctgaac      1560
     accgcacatg ccactgagaa ccacgggact ggcaaccata atgcccagtg accaacggct      1620
     tcccagggac tctcacatct cgggccccaa atggacagat cacccgagga gctggagggg      1680
     tcggccaagc tgactgtaaa tgtcacagtc cctctgaaaa aaccattgtg cttttgagac      1740
     cccagccccc ttcctggatg gaggctttga gggccctggg acatgttgtg ctatctgaaa      1800
     agattgggtc atcgctgcca aggtggagag cagtgagcaa ggggcttggg gcaatttcca      1860
     gtggagggca tctactcctc catttatgct tgtggttcac acatttaagt ttacaaatga      1920
     gatttctttt tcccccccta agtagaaata gattttcttt ttcaaccata attcaaatgc      1980
     aatcttaaga gctaatgtgg actttttttg ttccatgaaa tgtctttaaa ggatgaatta      2040
     gcatggtctt aaaatacatt tctgagatta ctagctgtat tttgaattgt aggcaaaatg      2100
     gtgagaaacc cagttggcgt ttatacaaat gctgacctca ggtctattgt tcttaaatgt      2160
     ggctaattct gtaacatagt cttggtattt ttcaattatg aatgcataac caatttctag      2220
     gcagatgcct tacttgaaca caaatccaaa agctaattta gaatcttctt tgcccagatc      2280
     ttttgagatt tacaccccag agatttaaga agaaaacctc taaatttcaa aattatgaag      2340
     aattacagaa ttactcattt aaggtacttt aaaagaagtt tgtacattgt caaagtaaat      2400
     tttaattcaa atcatgtctg taaaacttga cgtattttgt gtatgcatgt tttcatttta      2460
     caaatattta atatatagac ctatgatgta caggtacgac atgtataggt tacctagatg      2520
     ttatgagaaa ttttagttta ttgtgagtac tcaagttgct taaatagcca ccagggtgat      2580
     ttactgctgg ctttctatca tttttatgtt ttaatgcaaa ggaaattttt aaatgttcca      2640
     gaggtgtttt tgattaagca gtgcagccta gaagcaatgg ttcttttcaa tcattcagat      2700
     gttagtggaa gcctaaaagt caagactgca tgttgaaatt ttagttttga tagttacaga      2760
     actgcttggt taaactaaat ggaaccatgt gctcattttt cacaattatt gacctgtatt      2820
     gattgccact gtaatttgat attttcctat actttggtgg cctgcttccc tcatgccctg      2880
     gaatacaact cagagctcca ggcagcggaa ccatctattg ttttgtttgc cagaaagtgc      2940
     accctgtatg gtctcctgtc taagttggaa atattatgca tgtgcaggac tatttgaata      3000
     ttttataaac agtagcacac aataaattcc atgcatgggc cgctgctcct atctctgtgt      3060
     tgggttttat ttgggagatg aagtatgatt ggacctttta atgcaaatca aaaaatcttg      3120
     ttaatagagc tggaatatcc ttcagagaag attatcatgt gaacagtgca tggtgatttg      3180
     atgaattctt gtcttcataa attttgcttt ttaaaaaaaa aaaaaaaaaa aa              3232
//

If you have problems or comments...

PBIL Back to PBIL home page