(data stored in ACNUC7820 zone)

EMBL: AF546211

ID   AF546211; SV 1; linear; genomic DNA; STD; MAM; 600 BP.
XX
AC   AF546211;
XX
DT   16-OCT-2002 (Rel. 73, Created)
DT   22-MAR-2003 (Rel. 75, Last updated, Version 2)
XX
DE   Pan troglodytes clone 3a8p_chimp1 olfactory receptor gene, partial cds.
XX
KW   .
XX
OS   Pan troglodytes (chimpanzee)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Pan.
XX
RN   [1]
RP   1-600
RX   DOI; 10.1093/molbev/msg013.
RX   PUBMED; 12644552.
RA   Gilad Y., Lancet D.;
RT   "Population differences in the human functional olfactory repertoire";
RL   Mol. Biol. Evol. 20(3):307-314(2003).
XX
RN   [2]
RP   1-600
RA   Gilad Y., Lancet D.;
RT   ;
RL   Submitted (12-SEP-2002) to the INSDC.
RL   The Weizmann Institute of Science, Rehovot 76100, Israel
XX
DR   MD5; 6dbfbd91e1143aa9c6e20a84defe0cc5.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..600
FT                   /organism="Pan troglodytes"
FT                   /mol_type="genomic DNA"
FT                   /clone="3a8p_chimp1"
FT                   /db_xref="taxon:9598"
FT   mRNA            <1..>600
FT                   /product="olfactory receptor"
FT   CDS_pept        <1..>600
FT                   /codon_start=1
FT                   /product="olfactory receptor"
FT                   /db_xref="GOA:Q8HZL6"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/TrEMBL:Q8HZL6"
FT                   /protein_id="AAN40778.1"
FT                   /translation="CPVPAMLGRLLSHKSTISYDACLSQLFFFHLLAGMDCFLLTAMAY
FT                   DRFLAICRPLTYSTRMNQKVQRMLVAVSWTCAFTNALTHTIALTTLNFCGPSEINHFYC
FT                   DLPQLFQLSCSSTQLNELLLFVAAAVMAVAPLVFISVSYAHVVAAVLQIHSAEGRKKAF
FT                   STCGSHLTVVGIFYGTGVFSYMRLGSGESSDKEKGGG"
XX
SQ   Sequence 600 BP; 109 A; 186 C; 145 G; 158 T; 2 other;
     tgtcctgttc ctgcaatgtt gggtcgtctc ttgtcccaca agtccacaat ttcctatgac        60
     gcctgcctct cccagctctt cttcttccac cttctggctg ggatggactg cttcctgctg       120
     accgccatgg cctatgaccg attcctggcc atctgccggc ccctcactta cagcacccgc       180
     atgaatcaga aagtacagag gatgttggtg gctgtgtcct ggacttgtgc cttcaccaat       240
     gcactgaccc acactatygc cttaactacc ctcaacttct gtggccccag tgagatcaat       300
     cacttctact gtgacctccc acagctcttc cagctctcct gctccagcac ycaactcaat       360
     gagctgctgc tctttgtagc agcagccgtc atggctgtgg cgcccttggt cttcatcagc       420
     gtgtcctatg cccatgtggt agctgctgtg ctgcaaatcc actctgctga gggcagaaag       480
     aaggccttct ccacatgtgg ctcccacctc actgtggtgg gcatcttcta tgggacaggt       540
     gtcttcagct acatgaggct gggttcaggg gaatcttcag acaaggagaa ggggggtggg       600
//

If you have problems or comments...

PBIL Back to PBIL home page