(data stored in ACNUC1104 zone)

EMBL: AJ010320

ID   AJ010320; SV 2; linear; genomic DNA; STD; PRO; 2908 BP.
XX
AC   AJ010320;
XX
DT   01-OCT-1998 (Rel. 57, Created)
DT   24-NOV-1999 (Rel. 61, Last updated, Version 4)
XX
DE   Streptomyces coelicolor sigR and rsrA genes
XX
KW   anti-sigma factor; RNA polymerase sigma factor; rsrA gene; sigR gene.
XX
OS   Streptomyces coelicolor
OC   Bacteria; Actinobacteria; Streptomycetales; Streptomycetaceae;
OC   Streptomyces; Streptomyces albidoflavus group.
XX
RN   [1]
RC   Revised by [3]
RA   Paget M.S.B.;
RT   ;
RL   Submitted (18-AUG-1998) to the INSDC.
RL   Paget M.S.B., John Innes Centre, Department of Genetics, Norwich Research
RL   Park, Colney, Norwich, NR4 7UH, UK.
XX
RN   [2]
RX   DOI; 10.1093/emboj/17.19.5776.
RX   PUBMED; 9755177.
RA   Paget M.S.B., Kang J.G., Roe J.H., Butter M.J.;
RT   "sigmaR, an RNA polymerase sigma factor that modulates expression of the
RT   thioredoxin system in response to oxidative stress in Streptomyces
RT   coelicolor A3(2)";
RL   EMBO J. 17(19):5776-5782(1998).
XX
RN   [3]
RP   1-2908
RA   Paget M.S.B.;
RT   ;
RL   Submitted (23-NOV-1999) to the INSDC.
RL   Paget M.S.B., John Innes Centre, Department of Genetics, Norwich Research
RL   Park, Colney, Norwich, NR4 7UH, UK.
XX
RN   [4]
RX   DOI; 10.1093/emboj/18.15.4292.
RX   PUBMED; 10428967.
RA   Kang J.G., Paget M.S.B., Seok Y.J., Hahn M.Y., Bae J.B., Hahn J.S.;
RT   "RsrA, an anti-sigma factor regulated by redox change";
RL   EMBO J. 18(15):4292-4298(1999).
XX
DR   MD5; fbeec39624f287a2a72f3528b5c7b9d9.
DR   StrainInfo; 684630; 0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2908
FT                   /organism="Streptomyces coelicolor"
FT                   /strain="A3(2)"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:1902"
FT   mRNA            742..>1641
FT                   /gene="sigR"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   mRNA            917..>1641
FT                   /gene="sigR"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   CDS_pept        958..1641
FT                   /transl_table=11
FT                   /gene="sigR"
FT                   /product="RNA polymerase sigma factor"
FT                   /note="ECF sigma factor required for resistance to
FT                   oxidative stress"
FT                   /db_xref="GOA:Q7AKG9"
FT                   /db_xref="InterPro:IPR000838"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014293"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="PDB:1H3L"
FT                   /db_xref="PDB:5FGM"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7AKG9"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="CAA09088.1"
FT                   /translation="MGPVTGTDAGTEHGQAEQPEGRGTGAESTAERSARFERDALEFLD
FT                   QMYSAALRMTRNPADAEDLVQETYAKAYASFHQFREGTNLKAWLYRILTNTFINSYRKK
FT                   QREPQRSAAEEIEDWQLARAESHMSTGLRSAESQALDHLPDSDVKQALQAIPEEFRIAV
FT                   YLADVEGFAYKEIADIMGTPIGTVMSRLHRGRRQLRGMLEDYARDRGLVPAGAGESNEA
FT                   KGSGS"
FT   CDS_pept        1638..1955
FT                   /transl_table=11
FT                   /gene="rsrA"
FT                   /product="anti-sigma factor"
FT                   /note="A SigR-specific anti-sigma factor"
FT                   /db_xref="GOA:Q7AKG8"
FT                   /db_xref="InterPro:IPR014295"
FT                   /db_xref="InterPro:IPR024020"
FT                   /db_xref="InterPro:IPR027383"
FT                   /db_xref="PDB:5FRF"
FT                   /db_xref="PDB:5FRH"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7AKG8"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="CAB61633.1"
FT                   /translation="MSCGEPHETDCSEILDHLYEFLDKEMPDSDCVKFEHHFEECSPCL
FT                   EKYGLEQAVKKLVKRCCGQDDVPGDLRAKVMGRLDLIRSGQSVPEHDVAAAPSSSAPQE
FT                   S"
XX
SQ   Sequence 2908 BP; 409 A; 1036 C; 1048 G; 415 T; 0 other;
     ctcgaggagc tggaagcacc ggaagagggc acactcttct gacgtgacgg atgcgacaga        60
     ggttgtgaca gaggcggtcg agacggatgc gggccccgcc cgcatcacct ggcaccgggc       120
     gaagcagccc cggctggtgc tcgccgtgag ccacggggcc ggcggcggca tcgaggcgcg       180
     cgacctgaag gcgctggcgg ccgcactgcc cgcccacggg gtgagcgtgg ccctcgtcga       240
     gcagccctgg cgggtggcgg gcaggaagct ggcgcccgcg ccgaagaccc tcgacaccgg       300
     gtggcggggc gtctggcccg cgctcgccgc ccccggcctg ccggtgatct cgggcggccg       360
     cagcgccggc gcccgtgtcg cctgccgcac cgccggcgaa ctgggcgccc gcgccgtcct       420
     cgccctcagc ttccccctgc acccgccggg caggccggag aagtcccgcg ccgacgagct       480
     gctcggggcc ggcgtgccca ccctcgtggt ccagggcggc aacgacccct tcggcaggcc       540
     gcacgagttc cccgaggcgc ccggagggac ctacgacctg atcgaggtgc cgtacggcga       600
     ccacggcttc gccgtgccca aacgggcgga gatcagccag gaaagggcgc tggagctgat       660
     caccgacggc gtggcccagt gggccggctc actcggctga acgcctggga atgaccggcg       720
     gacggccact gttgtgccgt tcgtacgttg ctgagaatca gcaccgacgc cgtaggagag       780
     gaagtccgcc gcatgggttc agccttctgc ccgagtcgca gcagccgcgc cgacctggac       840
     tggaccgtgc tgcacgctgc caagaccgcc cctattcggg cggcgggcgg accggatcgt       900
     cgtctatcct ccgattcgag tgagaccggt ctcggtttca cgacgacatc ggaggaggtg       960
     ggtccggtca ctgggaccga cgcagggacc gaacacggcc aggcggagca gcccgagggc      1020
     cggggtacgg gcgcggagtc gaccgcggag cgcagcgcgc gcttcgagcg ggacgcgctg      1080
     gagttcctcg accagatgta ctcggccgcg ctgcgcatga cgcgtaatcc ggccgacgcc      1140
     gaggacctgg tgcaggagac ctacgccaag gcgtacgcgt ccttccacca gttccgcgag      1200
     ggcaccaacc tcaaggcgtg gctgtaccgc atcctcacca acaccttcat caactcgtac      1260
     cgcaagaagc agcgcgaacc ccagcgcagc gcggccgagg agatcgagga ctggcagctc      1320
     gcccgtgccg agtcgcacat gtcgacgggt ctgcgctccg cggagtcgca ggcgctcgac      1380
     cacctgcccg actcggacgt gaagcaggcg ctccaggcga tccccgagga attccgtatc      1440
     gccgtgtatc tggcggacgt cgagggcttt gcctacaagg agatcgcgga catcatgggg      1500
     acacccatcg gtacggtgat gtcccggctg caccgtggac gccgtcagct gcgcggcatg      1560
     ctggaggact acgcccgcga ccgcggtctg gtccccgccg gcgccggaga gtcgaacgaa      1620
     gcgaaaggct cggggtcatg agctgcggag agccgcacga gacggattgc agcgaaatcc      1680
     tcgatcatct ctacgagttt ctcgacaaag agatgccgga ctcggactgc gtgaagttcg      1740
     agcaccactt cgaggagtgc tcgccctgcc tggagaagta cgggctggag caggccgtga      1800
     agaagctggt caagcggtgc tgcgggcagg acgacgtgcc cggtgacctg cgggccaagg      1860
     tgatgggacg gctggacctg atccggtccg ggcagtccgt gccggaacac gacgtcgcgg      1920
     ccgcaccgtc gtcgtcggcc ccgcaggagt cctgagtcgc cctgagcgtc gcgactcggc      1980
     cagaagtcac tcgtacgtgc taatccgcgg gttatctgcc cgcggcctcc ccgccgccgt      2040
     cctaggctcc tgagcctgac aggcgtggcc aggggagggg ctgatggacg cggtaccggc      2100
     gcgggcacgt gtgtacgtgg ccgtcgtcgc cctcaccgcc ctgctctgcc tgcgaccgct      2160
     gcccgcggtg cgcgcgccct ggtgggcggt gctgctgctg gcggggctgt acgcggggtc      2220
     cgagctggtc gcgcggtccc gcttcgtcgg gacctgctac cccgtcctgc tcgccggcgc      2280
     cttcctgctg ccgccgcccg ccgccgcgct cgtggcactg ccgggagccc tgctggcccc      2340
     ggtgccgcgc cgtcccctcg gcctgcggcg cgtgtggcgg gccgcgcagc tgactctcgc      2400
     cgtgtgggcc gcggcctgtg tccactggcg gctcgggggc cgggacgcgg tcgtcgagcc      2460
     cgccttcccg tacgccctcg tgccggccgg ggcggccgta ctcgccttct gcctggtcct      2520
     caccgtgctg gacggcggca tcctcaccct cgccgaccac gtgccgccga gccgggcgtg      2580
     gcggggactg ctctcccggt cgctcgcgcc gatcgccgtg cacgggctcg ccgggctcat      2640
     gatggccgtc ctgtggcgca gcccgtacgg tccggtggcc gcgctgctcg tgctgctgcc      2700
     gatgtgcgtg gcctggtggg ccttcgccca gtaccaccgt gagcgggccg cgcaccaggc      2760
     gaccatccgc gccctcgtgc aggccgtcga catcaaggac ggctacacgc gcggccacag      2820
     cgaacgcgtc ggccaggcct ccatgatgat cgcccgcgag ctgggcatgg acgacgaacg      2880
     cgtcgagacc ctgcgcttcg ccgggatc                                         2908
//

If you have problems or comments...

PBIL Back to PBIL home page