(data stored in ACNUC1829 zone)

EMBL: AJ012589

ID   AJ012589; SV 1; linear; mRNA; STD; MAM; 877 BP.
XX
AC   AJ012589;
XX
DT   06-APR-1999 (Rel. 59, Created)
DT   17-NOV-2004 (Rel. 81, Last updated, Version 3)
XX
DE   Bos taurus mRNA for CD63 protein
XX
KW   cd63 gene; CD63 protein.
XX
OS   Bos taurus (cattle)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia; Pecora; Bovidae;
OC   Bovinae; Bos.
XX
RN   [1]
RP   1-877
RA   Brooke G.P.;
RT   ;
RL   Submitted (05-NOV-1998) to the INSDC.
RL   Brooke G.P., Immunology, Institute for Animal Health, IAH, Compton, Berks.,
RL   RG20 7NN, UK.
XX
RN   [2]
RX   DOI; 10.1007/s002510050556.
RX   PUBMED; 10398809.
RA   Brooke G.P., Sopp P., Kwong L., Howard C.J.;
RT   "Molecular cloning of cattle CD63 and evidence for high level expression on
RT   subpopulations of dendritic cells";
RL   Immunogenetics 49(9):812-814(1999).
XX
DR   MD5; 0357b10c6549e7e7578c440a9aa113e4.
DR   Ensembl-Gn; ENSBTAG00000011931; bos_taurus.
DR   Ensembl-Tr; ENSBTAT00000015829; bos_taurus.
DR   EuropePMC; PMC1590031; 16948847.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..877
FT                   /organism="Bos taurus"
FT                   /mol_type="mRNA"
FT                   /clone="CC25"
FT                   /cell_type="monocyte"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9913"
FT   CDS_pept        53..766
FT                   /gene="cd63"
FT                   /product="CD63 protein"
FT                   /db_xref="GOA:Q9XSK2"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="InterPro:IPR018503"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9XSK2"
FT                   /protein_id="CAB40564.1"
FT                   /translation="MAVEGGMKCVKFLLYVLLLVFCACAVGLIAVGVGTHLVLNQTITH
FT                   GATPSFLLPVVIIAVGAFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAAAIAG
FT                   YVFRDKVRSEFNKDFRQQMKNYPKDNQTASILDKMQKDFECCGAANYTDWEKILAVTNK
FT                   VPDSCCVNITHNCGINFVVKDIHTEGCVEKIAAWLRKNVLVVVAAALGIAFVEILGIVL
FT                   ACCLVKSIRSGYEVM"
XX
SQ   Sequence 877 BP; 203 A; 200 C; 249 G; 225 T; 0 other;
     aaaggcggcg ggagagcagc acacagcctc cgggagccca ggccaggcag ccatggcggt        60
     ggaaggagga atgaaatgtg tcaagtttct gctctacgtt ctcctgctgg tcttctgcgc       120
     ctgtgcggtg ggactgattg ctgtgggcgt agggacccac ctcgtcctga atcagactat       180
     cacccatggg gccaccccta gtttcctgtt gcctgtggtc atcatcgcag tgggggcctt       240
     cctcttcctg gtggcctttg tgggctgctg tggagcctgc aaggagaact actgtcttat       300
     gatcacattt gccatcttct tgtcccttat catgctagtt gaagtggctg cagccattgc       360
     tggctatgtg tttagagaca aggtgagatc agaatttaat aaggacttcc ggcagcagat       420
     gaagaattat ccaaaagaca accagacggc atcgatcctg gataagatgc agaaagattt       480
     tgagtgctgc ggggcggcta actacacaga ctgggagaag atcctggccg tgaccaataa       540
     agtccctgac tcctgctgcg tcaatatcac tcataactgt gggattaatt tcgttgtgaa       600
     ggacatccat actgagggct gtgtggagaa gattgcggcc tggctgagga agaatgtgct       660
     ggtggtggtt gcggcagccc taggcattgc ctttgtggag atcctgggta ttgtcttagc       720
     atgctgcctt gtgaagagca tccgaagtgg ttatgaggtg atgtaggggt ctttttcccc       780
     cccctcatcc ggggaggggg gtaatatact ccaggttttt caattaaacg gattattttt       840
     tcagaccccc caaaaaaaaa aaaaaaaaaa ctttcca                                877
//

If you have problems or comments...

PBIL Back to PBIL home page