(data stored in ACNUC22795 zone)

EMBL: AJ012825

ID   AJ012825; SV 1; linear; genomic DNA; STD; HUM; 2794 BP.
XX
AC   AJ012825;
XX
DT   06-JAN-2001 (Rel. 66, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 2)
XX
DE   Homo sapiens psoriasin (S100A7) gene
XX
KW   psoriasin gene.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2794
RA   Glaeser R.;
RT   ;
RL   Submitted (16-NOV-1998) to the INSDC.
RL   Glaeser R., Dermatology, University of Kiel, Schittenhelmstrasse 7, 24105
RL   Kiel, GERMANY.
XX
RN   [2]
RA   Glaeser R., Harder J., Christophers E., Schroeder J.M.;
RT   "Genomic organization of human psoriasin (S100A7) gene";
RL   Unpublished.
XX
DR   MD5; 8d99fec97e439f1ac49bdab2de21c279.
DR   Ensembl-Gn; ENSG00000143556; homo_sapiens.
DR   Ensembl-Tr; ENST00000368722; homo_sapiens.
DR   Ensembl-Tr; ENST00000368723; homo_sapiens.
DR   EuropePMC; PMC4518584; 26225121.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2794
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(1..30,1607..1764,2667..>2794)
FT                   /gene="psoriasin"
FT   exon            1..30
FT                   /gene="psoriasin"
FT                   /number=1
FT   intron          31..1606
FT                   /gene="psoriasin"
FT                   /number=1
FT   exon            1607..1764
FT                   /gene="psoriasin"
FT                   /number=2
FT   CDS_pept        join(1624..1764,2667..>2794)
FT                   /gene="psoriasin"
FT                   /db_xref="GOA:P31151"
FT                   /db_xref="HGNC:HGNC:10497"
FT                   /db_xref="InterPro:IPR001751"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR013787"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR028477"
FT                   /db_xref="InterPro:IPR034325"
FT                   /db_xref="PDB:1PSR"
FT                   /db_xref="PDB:2PSR"
FT                   /db_xref="PDB:2WND"
FT                   /db_xref="PDB:2WOR"
FT                   /db_xref="PDB:2WOS"
FT                   /db_xref="PDB:3PSR"
FT                   /db_xref="PDB:4AQJ"
FT                   /db_xref="UniProtKB/Swiss-Prot:P31151"
FT                   /protein_id="CAC20409.1"
FT                   /translation="MSNTQAERSIIGMIDMFHKYTRRDDKIDKPSLLTMMKENFPNFLS
FT                   ACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQ"
FT   intron          1765..2666
FT                   /gene="psoriasin"
FT                   /number=2
FT   exon            2667..>2794
FT                   /gene="psoriasin"
FT                   /number=3
XX
SQ   Sequence 2794 BP; 681 A; 741 C; 681 G; 691 T; 0 other;
     ttcttctact cgtgacgctt cccagctctg gtaagtctca cctgcctctt tgcgttttct        60
     agaagtgccc agtgcctggc ctgccatgct gcctgtagga agggaaaggg ctgtggacaa       120
     agactcagaa gcctggggtc taggccagct ctgccattag ctgggctgtg tgaccctcac       180
     ttgaccccaa aagcccacgt ctgtataacc aagtggctga accagacctg tccattgctc       240
     ctttggggtc tcctgaggca actcctgtgg aaatgtcccc agtgggacct gagcacagga       300
     ccctccctgt cctcttcctc cctggattca tcctcctgtt ggggtcccgg ttgctaaatc       360
     cccctcccca gctccggctc cacagagggt ggagggctag gggtcccctg ttgaattgct       420
     ttggaggctc tccaaacccc caggcctgga cccgacacag catagcctgg cagatggttt       480
     gccctacctg ggtaaggtat tgagaaacca gacgctccgt cactccctac cacaacctgc       540
     aaattgtcag tcaccctctg ggcacagggc ttgcctctgg ccttgcttcc agattcaaaa       600
     aagctctggg tggctcctct tagtcagttg ccggcatgga gctttctcct gcattgagag       660
     gtgttggggg tttattgtca gacacccata tgcattagcc aaggtccttt cctggttctt       720
     tggaaagtgt gggaagtgag aactgcactg tcctattttt caggcttggg gtgcaggcca       780
     gcccagactg actactggct gaaagatctg ctttgggaag tcagacattt ttatttaaac       840
     aggtcaagcc ttggtgattc agagggtgca gataattccc aagagcagac atgaagtgac       900
     tcccacctca ctcccacccc gtccagcagc ttaagaacca gagagttatt tctgttcctt       960
     gtaacagagg ccattcctgt ttctcgttcc caagggaata caagaagggc cccctgtgct      1020
     cgggacagga ctgtgtttcc tgctaacact cacgtccacg ctcacatgtg cacctggagc      1080
     ctgcacacac cgtgtcatgc agggcttgca cttgagtcaa ggtggggccc acggtgtctg      1140
     gttcctgaag cagccgagga gggtcaggca ccagatcacc aaggccattg tcctgccccc      1200
     atgactgtca cccgactgtg aagctggagg agatggattt ggtgctcttt taagagtggg      1260
     gtctgccatg tgctggctga ggctggggtg tcccagctta gttcttccat gtgttgctgg      1320
     cgcccgactc tccctgcttc tccctctctg aagcactgtc cacagctgga cttccgccat      1380
     ccacctgcat ctcctcttgg ccctggccag gatgggccag gtctcagact tggtcctacc      1440
     ctctcatttt tgagcaactt atcccatcac attaaaaaaa aattgagttc gttctgctac      1500
     accttatccg tgtttttact ctgtcctcag ccctccttcc agcactccca aatagagacc      1560
     ctaacttaaa tgaagggaaa aaaatgattg tctttatttc ctgaaggctt tttgaaagca      1620
     aagatgagca acactcaagc tgagaggtcc ataataggca tgatcgacat gtttcacaaa      1680
     tacaccagac gtgatgacaa gattgacaag ccaagcctgc tgacgatgat gaaggagaac      1740
     ttccccaact tccttagtgc ctgtgtgagt cggtgtctag cttctcaatg ttggaggata      1800
     cattttgcta tgtggccttg gacagatcac ccgcaccctc tgattaaaaa atttccccat      1860
     ttgcaaatag ggcttattac ttggatcata tgtgaatcta aggatggtag gcgaaaaagt      1920
     atgaaaatgg gaaagagtta tacagatata aaggaggtta ttagatggtc agcaaagtgt      1980
     gcagcttgag ggcagtgcac agtcccctcc cagcactcac tgaccctctc tctgtgagac      2040
     tgaaactcac atgctcaggt cctgtttccc aaaggcccca catcaacatc cctgagatta      2100
     ctgggaaagc actagaagtt ccattgttag tagaaatcaa tagccctctt tgcaataaac      2160
     aagactcatt agcaaatctg aaaaaaaact gtgggctact aggtaccaaa gggtctagat      2220
     gaccaagagt aggataccca gaagatgagt ttggtggaaa aggagaagaa aggagaggag      2280
     gccagagaaa gaagagaaca aaagcatgag ggccaatttt gaggccctgg ggtagaacta      2340
     aggtaggcag tgcccttaga ggctgggacg ggaaagagtg aggctggggc aggggactgc      2400
     tctccccaag gtcacttaac agagcacctt gggacaggac ctgcctccca tcctgaggtg      2460
     tgagacaaaa agactcccta gagaactcca gggataacac tcacgtcctc accccaactt      2520
     cacccactca ccctgtgctc tcagccccgc caccatgcct gtgcagatct aggtacttgt      2580
     ctgtatctct gcctcctcct ctccctccca gcccaaaact tgtttgtgat tgaatttttc      2640
     tattttgtat gtttttctct tcacaggaca aaaagggcac aaattacctc gccgacgtct      2700
     ttgagaaaaa ggacaagaat gaggataaga agattgattt ttctgagttt ctgtccttgc      2760
     tgggagacat agccacagac taccacaagc agag                                  2794
//

If you have problems or comments...

PBIL Back to PBIL home page