(data stored in ACNUC7421 zone)

EMBL: AJ243594

ID   AJ243594; SV 2; linear; genomic DNA; STD; PRO; 2241 BP.
XX
AC   AJ243594;
XX
DT   13-JUL-1999 (Rel. 60, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 4)
XX
DE   Pseudoalteromonas haloplanktis groEL, groES genes
XX
KW   groEL gene; GroEL protein; groES gene; GROES protein.
XX
OS   Pseudoalteromonas haloplanktis
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Alteromonadales;
OC   Pseudoalteromonadaceae; Pseudoalteromonas.
XX
RN   [1]
RC   Revised by [3]
RA   Tosco A.;
RT   ;
RL   Submitted (12-JUL-1999) to the INSDC.
RL   Tosco A., Organic and Biological Chemistry, University of Naples, via
RL   Mezzocannone 16 (NA), I-80134, ITALY.
XX
RN   [2]
RX   PUBMED; 12579376.
RA   Tosco A., Birolo L., Madonna S., Lolli G., Sannia G., Marino G.;
RT   "GroEL from the psychrophilic bacterium Pseudoalteromonas haloplanktis TAC
RT   125: molecular characterization and gene cloning";
RL   Extremophiles 7(1):17-28(2003).
XX
RN   [3]
RP   1-2241
RA   Stefania M.;
RT   ;
RL   Submitted (05-FEB-2001) to the INSDC.
RL   Stefania M., Organic and Biological Chemistry, University of Naples, via
RL   Mezzocannone 16 (NA), I-80134, ITALY.
XX
DR   MD5; ac06759e4c052933166ae29681fa38fa.
DR   StrainInfo; 764141; 0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2241
FT                   /organism="Pseudoalteromonas haloplanktis"
FT                   /strain="TAC125"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:228"
FT   regulatory      71..83
FT                   /gene="groESL"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /regulatory_class="minus_35_signal"
FT   regulatory      97..105
FT                   /gene="groESL"
FT                   /note="sigma 32-dependent promoter"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /regulatory_class="minus_10_signal"
FT   regulatory      105..110
FT                   /gene="groESL"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /regulatory_class="minus_35_signal"
FT   regulatory      128..133
FT                   /gene="groESL"
FT                   /note="sigma 70-dependent promoter"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /regulatory_class="minus_10_signal"
FT   regulatory      153..156
FT                   /gene="groES"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        168..455
FT                   /transl_table=11
FT                   /gene="groES"
FT                   /product="groES protein"
FT                   /function="molecular co-chaperone"
FT                   /db_xref="GOA:Q9AKT2"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9AKT2"
FT                   /protein_id="CAC28359.1"
FT                   /translation="MNIRPLHDRVIVKRLEEETKSAGGIVLTGSAAEKSTRGEVVAVGN
FT                   GRILESGDVRALEVKAGDTVLFGSYVEKVEKIEGQEYLIMREDNILGIVG"
FT   regulatory      489..493
FT                   /gene="groEL"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        504..2147
FT                   /transl_table=11
FT                   /gene="groEL"
FT                   /product="GroEL protein"
FT                   /function="molecular chaperone"
FT                   /db_xref="GOA:Q9XAU7"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9XAU7"
FT                   /protein_id="CAB50775.1"
FT                   /translation="MAAKEVLFAGDARAKMLTGVNILANAVKVTLGPKGRNVVLDKSFG
FT                   SPVITKDGVSVAKEIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQSIVNEGL
FT                   KAVAAGMNPMDLKRGIDKAVIAAVAELKALSVPCSDTKAIAQVGTISANSDKEIGDIIA
FT                   QAMEKVGRNSGVITVEEGQSLENELDVVEGMQFDRGYLSPYFINSPEKGTVELDNPFIL
FT                   LVDKKISNIRELLPTLEAVAKASKPLLIIAEDLEGEALATLVVNNMRGIVKVSAVKAPG
FT                   FGDRRKAMLQDIAVLTGGTVISEEIGLELEKATVEDLGTAERVIITKDDTTIIDGAGEE
FT                   AGINGRVSQIKAQIEEATSDYDKEKLQERMAKLAGGVAVIKVGAATEMEMKEKKDRVED
FT                   ALNATRAAVEEGVVPGGGVALVRAASKLVDLVGDNEDQNHGIKVALRAMEAPLRQIVTN
FT                   AGDEASVVINAVKAGSGNFGYNAATGEYNDMIEMGILDPTKVTRSALQFAGSIAGLMIT
FT                   TEAMVAEIPKDDSAPDMGGMGGMGGMGGMM"
FT   regulatory      2178..2202
FT                   /gene="groESL"
FT                   /regulatory_class="terminator"
XX
SQ   Sequence 2241 BP; 735 A; 416 C; 511 G; 579 T; 0 other;
     gatcctcatc aagtgaacaa accgaccatc atagatggtg agtttgaacg aaaagattaa        60
     tttttttaat tttacgcttg gattttggcg taacaccccc attattgaat gcaaccaata       120
     taagcttttt tctgcccttc gcagaaactg ttaggagaac taaataaatg aatattcgtc       180
     ctttacatga tcgcgtgatc gttaagcgtc tagaagaaga aacaaaatct gctggcggta       240
     ttgtattaac tggctctgca gctgaaaaat caacccgcgg agaagttgtt gccgttggta       300
     atggtcgcat tttagaaagc ggtgatgtta gagcattaga agttaaagcc ggtgacacag       360
     tgttatttgg ctcatatgtt gagaaagttg aaaagatcga aggtcaagag tacctgatca       420
     tgcgtgaaga taatatttta ggcattgtag gctaaaccta cttttcgttt ataaacattt       480
     aagaatttag aggaatttaa aacatggcag caaaagaagt actttttgca ggtgacgcac       540
     gcgctaaaat gctaactggc gtaaacatcc tggcaaacgc agtaaaagtt acattaggtc       600
     ctaaaggccg taacgttgta ctagataaat catttggctc tccagttatc actaaagatg       660
     gtgtatctgt agcaaaagaa atcgaacttg aagacaagtt tgagaacatg ggcgcacaaa       720
     tggttaaaga agttgcatct aaagctaacg atgcagccgg cgatggtaca actaccgcta       780
     cagtacttgc acagtctatt gtaaacgaag gccttaaagc tgttgcagca ggcatgaacc       840
     caatggacct taagcgcggc atcgacaaag cagtaattgc tgctgttgca gagcttaaag       900
     cgttatctgt tccatgctct gacactaaag caattgcaca agtaggtact atttcagcta       960
     actctgataa agagattggc gacatcattg cacaagcaat ggaaaaagta ggccgtaaca      1020
     gtggtgttat tactgtagaa gaaggtcaat cactagaaaa tgaactcgat gttgttgaag      1080
     gcatgcagtt tgaccgtggt tacctatctc cttactttat taacagccca gaaaaaggta      1140
     ctgttgaact agataaccca tttattctac ttgtagataa aaaaatatct aacattcgcg      1200
     aattattacc aacattagaa gcagttgcta aagcaagcaa gccactacta atcatcgcag      1260
     aagaccttga aggcgaagca ttagctacat tagtagttaa taacatgcgt ggtattgtta      1320
     aagtatcagc agtgaaagct cctggttttg gcgaccgtcg taaagcaatg ctacaagata      1380
     tcgctgtatt aactggcggt actgtgattt cagaagaaat cggccttgag cttgaaaaag      1440
     caacagttga agacctaggt acagctgagc gcgtaattat cactaaagat gatacaacaa      1500
     tcattgatgg tgctggcgaa gaagcaggta ttaacggccg tgtttcacaa attaaagcac      1560
     aaatcgaaga agcaacatca gactacgata aagaaaaact acaagagcgc atggctaaac      1620
     tagctggcgg tgttgcagta atcaaagttg gtgctgcgac tgaaatggaa atgaaagaga      1680
     aaaaagaccg cgttgaagat gcattaaatg caactcgtgc agcggttgaa gaaggtgtag      1740
     tacctggcgg cggcgttgca ctagttcgtg cagcaagtaa gctggttgat ttagttggcg      1800
     acaacgaaga tcaaaaccac ggtattaaag ttgcacttcg tgcaatggaa gcgccacttc      1860
     gtcaaatcgt aacaaacgca ggtgacgaag cttcagttgt aattaacgca gttaaagcag      1920
     gttcaggtaa ctttggttac aatgctgcta ctggcgaata caatgacatg attgaaatgg      1980
     gtatcctaga tccaactaaa gtaacgcgct ctgcactaca atttgcaggg tctattgcgg      2040
     gtctaatgat cactaccgaa gctatggtag ctgaaatccc taaagatgat agcgctcctg      2100
     atatgggtgg catgggcggt atgggtggaa tgggcggtat gatgtaaacc ccacctaaac      2160
     ctcccggtta aaaaaaccca gcctcggctg gtttttaatg ttatagaaaa aataaaaaac      2220
     taactatact cttagtcact t                                                2241
//

If you have problems or comments...

PBIL Back to PBIL home page