(data stored in SCRATCH zone)

EMBL: AJ272134

ID   AJ272134; SV 1; linear; mRNA; STD; HUM; 313 BP.
XX
AC   AJ272134;
XX
DT   11-FEB-2000 (Rel. 62, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Homo sapiens partial mRNA for transcription factor SP1 (SP1 gene)
XX
KW   Sp1 gene; transcription factor SP1.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-313
RA   Handschug K.;
RT   ;
RL   Submitted (10-FEB-2000) to the INSDC.
RL   Handschug K., Technical University Dresden, Children's Hospital,
RL   Fetscherstr. 74, 01307 Dresden, GERMANY.
XX
RN   [2]
RA   Handschug K., Huebner A.;
RT   "Sequencing of the 5' end of human transcription factor SP1 mRNA.";
RL   Unpublished.
XX
DR   MD5; dadf2574940ed773641c513593bb68ed.
DR   Ensembl-Gn; ENSG00000185591; homo_sapiens.
DR   Ensembl-Tr; ENST00000327443; homo_sapiens.
DR   Ensembl-Tr; ENST00000426431; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..313
FT                   /organism="Homo sapiens"
FT                   /chromosome="12"
FT                   /map="12q13"
FT                   /mol_type="mRNA"
FT                   /cell_type="cultured fibroblasts and lymphocytes"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        19..>313
FT                   /gene="SP1"
FT                   /product="transcription factor SP1"
FT                   /db_xref="GOA:P08047"
FT                   /db_xref="H-InvDB:HIT000246228.11"
FT                   /db_xref="HGNC:HGNC:11205"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="PDB:1SP1"
FT                   /db_xref="PDB:1SP2"
FT                   /db_xref="PDB:1VA1"
FT                   /db_xref="PDB:1VA2"
FT                   /db_xref="PDB:1VA3"
FT                   /db_xref="UniProtKB/Swiss-Prot:P08047"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="CAB75345.1"
FT                   /translation="MSDQDHSMDEMTAVVKIEKGVGGNNGGNGNGGGAFSQARSSSTGS
FT                   SSSTGGGGQESQPSPLALLAATCSRIESPNENSNNSQGPSQSGGTGELDLTAT"
XX
SQ   Sequence 313 BP; 86 A; 78 C; 94 G; 55 T; 0 other;
     tgtccctcag ctgccaccat gagcgaccaa gatcactcca tggatgaaat gacagctgtg        60
     gtgaaaattg aaaaaggagt tggtggcaat aatgggggca atggtaatgg tggtggtgcc       120
     ttttcacagg ctcgaagtag cagcacaggc agtagcagca gcactggagg aggagggcag       180
     gagtcccagc catccccttt ggctctgctg gcagcaactt gcagcagaat tgagtcaccc       240
     aatgagaaca gcaacaactc ccagggcccg agtcagtcag ggggaacagg tgagcttgac       300
     ctcacagcca cac                                                          313
//

If you have problems or comments...

PBIL Back to PBIL home page