(data stored in ACNUC7820 zone)

EMBL: AJ431498

ID   AJ431498; SV 1; linear; genomic DNA; STD; MAM; 337 BP.
XX
AC   AJ431498;
XX
DT   01-DEC-2003 (Rel. 78, Created)
DT   17-DEC-2003 (Rel. 78, Last updated, Version 2)
XX
DE   Canis familiaris partial OR12B11 gene for olfactory receptor
XX
KW   olfactory receptor; OR12B11 gene.
XX
OS   Canis lupus familiaris (dog)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Laurasiatheria; Carnivora; Caniformia; Canidae; Canis.
XX
RN   [1]
RP   1-337
RA   Quignon P.;
RT   ;
RL   Submitted (04-FEB-2002) to the INSDC.
RL   Quignon P., Laboratoire de Genetique et Developement, CNRS UMR6061, Faculte
RL   de Medecine. 2, avenue Pr. Leon Bernard. Rennes, 35043, FRANCE.
XX
RN   [2]
RX   DOI; 10.1186/gb-2003-4-12-r80.
RX   PUBMED; 14659017.
RA   Quignon P., Guyon R., Renier C., Cadieu E., Hitte C., Andre C.,
RA   Galibert F.;
RT   "Comparison of the canine and human olfactory receptor gene repertoires";
RL   Genome Biol. 4(12):R80-R80(2003).
XX
DR   MD5; 8250144ba15a305d7922ecaa936e6652.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..337
FT                   /organism="Canis lupus familiaris"
FT                   /chromosome="27"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="MDCK"
FT                   /db_xref="taxon:9615"
FT   CDS_pept        <1..>337
FT                   /codon_start=2
FT                   /gene="OR12B11"
FT                   /product="olfactory receptor"
FT                   /db_xref="GOA:Q70ZB6"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/TrEMBL:Q70ZB6"
FT                   /protein_id="CAD24208.1"
FT                   /translation="YPLVYTMVINRPLCIVTVSIAWTVGFLISLMNILFIYKLHFCGSN
FT                   IIPHFSCELPPLFPLSCTDPIVNEILLAVSCAFLGLLTLPLILFSYSRIISAILNIRSS
FT                   EGQAKAFS"
XX
SQ   Sequence 337 BP; 67 A; 97 C; 59 G; 114 T; 0 other;
     ctaccctctg gtctacacca tggtcataaa caggcctctc tgtattgtga ctgtgagtat        60
     agcttggaca gtgggatttc tgatttcctt gatgaatatt cttttcatct acaagttaca       120
     tttctgtggg tccaacatta tcccccattt cagctgtgag ctacctccgc tctttcctct       180
     gtcctgtaca gatcccattg tcaatgagat tcttctagca gtgtcatgtg cgtttctggg       240
     actgctgaca cttcccctaa tcctcttctc ttactccaga atcatttctg ccattctgaa       300
     catccgctcc tctgagggcc aagccaaagc cttctcc                                337
//

If you have problems or comments...

PBIL Back to PBIL home page