(data stored in ACNUC7820 zone)

EMBL: AJ431569

ID   AJ431569; SV 1; linear; genomic DNA; STD; MAM; 627 BP.
XX
AC   AJ431569;
XX
DT   01-DEC-2003 (Rel. 78, Created)
DT   17-DEC-2003 (Rel. 78, Last updated, Version 2)
XX
DE   Canis familiaris partial OR28H08 gene for olfactory receptor
XX
KW   olfactory receptor; OR28H08 gene.
XX
OS   Canis lupus familiaris (dog)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Laurasiatheria; Carnivora; Caniformia; Canidae; Canis.
XX
RN   [1]
RP   1-627
RA   Quignon P.;
RT   ;
RL   Submitted (04-FEB-2002) to the INSDC.
RL   Quignon P., Laboratoire de Genetique et Developement, CNRS UMR6061, Faculte
RL   de Medecine. 2, avenue Pr. Leon Bernard. Rennes, 35043, FRANCE.
XX
RN   [2]
RX   DOI; 10.1186/gb-2003-4-12-r80.
RX   PUBMED; 14659017.
RA   Quignon P., Guyon R., Renier C., Cadieu E., Hitte C., Andre C.,
RA   Galibert F.;
RT   "Comparison of the canine and human olfactory receptor gene repertoires";
RL   Genome Biol. 4(12):R80-R80(2003).
XX
DR   MD5; c025e013e352fa890ddd6e2f86bec1b7.
DR   EuropePMC; PMC329419; 14659017.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..627
FT                   /organism="Canis lupus familiaris"
FT                   /chromosome="20"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="MDCK"
FT                   /db_xref="taxon:9615"
FT   CDS_pept        <1..>627
FT                   /codon_start=2
FT                   /gene="OR28H08"
FT                   /product="olfactory receptor"
FT                   /db_xref="GOA:Q70Z54"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/TrEMBL:Q70Z54"
FT                   /protein_id="CAD24279.1"
FT                   /translation="FVDICFTTRTIPKMLVNIRTHSKSITYTGCLTQICFVLTFAGLEN
FT                   GILVMMAFDRFVAICHPLRYNVIMNPKLCRLLVLLSFLISVLDALLHTLMALRLSFCTD
FT                   LEIPHFFCELAHILKLACSDILINNILVYLVTSLLGVIPLSGIIISYTQIVSSVLKIPS
FT                   AGGKYKAFSICGSHLIVVSLFYGTGFGVYLSSAATHSSRKSAIVSV"
XX
SQ   Sequence 627 BP; 144 A; 151 C; 120 G; 212 T; 0 other;
     ttttgttgac atctgtttca ccaccagaac aatcccaaag atgcttgtaa acatccggac        60
     acacagcaaa tccatcactt acacaggctg cctcacacaa atctgctttg tcctgacttt       120
     tgctggatta gaaaatggaa tactggtaat gatggccttt gatcgatttg tggccatctg       180
     tcacccattg aggtacaatg tcatcatgaa tcccaaactc tgtaggctgc tggttctact       240
     gtccttcctt attagtgttt tggatgccct tctccacact ttgatggcgt tgcggctgtc       300
     cttctgcaca gacctggaaa ttccccactt tttctgtgaa ttagctcata ttctcaagct       360
     tgcctgttcc gatatcctca tcaataatat tcttgtgtat ttagtgacca gcttgttggg       420
     tgttattcct ctctctggga taattatctc ttacactcaa attgtttcct ctgtcctgaa       480
     aatcccatca gctggtggaa agtataaggc attttccatc tgtgggtcac acttaatagt       540
     tgtttctttg ttctatggga caggttttgg ggtgtacctt agttccgcag ctacacactc       600
     ctccaggaag agcgcaatag tatcagt                                           627
//

If you have problems or comments...

PBIL Back to PBIL home page