(data stored in ACNUC7421 zone)

EMBL: AJ438778

ID   AJ438778; SV 1; linear; genomic DNA; STD; FUN; 2837 BP.
XX
AC   AJ438778;
XX
DT   07-JAN-2005 (Rel. 82, Created)
DT   16-APR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   Eremothecium gossypii SHM1 gene for serine hydroxymethyltransferase
XX
KW   serine hydroxymethyltransferase; SHM1 gene.
XX
OS   Eremothecium gossypii
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes;
OC   Saccharomycetales; Saccharomycetaceae; Eremothecium.
XX
RN   [1]
RP   1-2837
RA   Revuelta J.L.;
RT   ;
RL   Submitted (11-MAR-2002) to the INSDC.
RL   Revuelta J.L., Mibrociologia y Genetica/IMB, Universidad de Salamanca/CSIC,
RL   Campus Unamuno, Edificio Departamental. Lab. 323, Salamanca, 37007, SPAIN.
XX
RN   [2]
RA   Santos M.A., Revuelta J.L.;
RT   "Characterization of Ashbya gossypii AgSHM1 and AgSHM2 genes";
RL   Unpublished.
XX
DR   MD5; e456725920b82bebe8c379c68acb0735.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2837
FT                   /organism="Eremothecium gossypii"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:33169"
FT   CDS_pept        610..2103
FT                   /gene="SHM1"
FT                   /product="mitochondrial serine hydroxymethyltransferase"
FT                   /function="glycine metabolism"
FT                   /EC_number="2.1.2.1"
FT                   /db_xref="GOA:Q758F0"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q758F0"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="CAD27655.1"
FT                   /translation="MFIRRLHTSSRRLTCGEALRACQQTGARSANGQLMLSQHVQEFDP
FT                   EMYDILTKERSRQKRSITLIPSENFTSVAVMNLLGSEMQNKYSERYPGQRYYGGNQYID
FT                   MAESLCQKRALELYGLDPAKWGVNVQSLSGAPANLYAYSAIMEVGDRMMGLDLPHGGHL
FT                   SHGYQLQNGNKISYISKYFQTMAYRVDPATGLVDYDTLSETSKLFRPKVIVAGTSAYAR
FT                   VLDYKRFREIADACGAYLLSDMAHVSGLVAAGVHPSPFEYSDIVTTTTHKSLRGPRGAM
FT                   IFYRKGIRKVTKKGTEIMYDLDKRINFSVFPAHQGGPHNHTISALAVALKQAATPEFKN
FT                   YQTAVVENAKVFGEELSKRGFSLVSGGTDTHLLLIDLSPMGIDGSRLETILERLNIAAN
FT                   KNTIPGDKSALYPSGLRVGTPAMTTRGFGPAEFGRVAAYINEAVKLAIGLKSQEPVDAK
FT                   DAKTRLAHFKSFCAESEQVTKLANEVADWVAQYPVPGEL"
FT   sig_peptide     610..693
FT                   /gene="SHM1"
FT   mat_peptide     694..2100
FT                   /gene="SHM1"
XX
SQ   Sequence 2837 BP; 684 A; 728 C; 702 G; 707 T; 16 other;
     tagtcccagt gcggggaccg ttatcggggc aaatgggtta aggcagaggg gcggcgccgg        60
     atccgtctga actattggta ttgagtcaga gaagcaaacg tctctgatta gagtgcggaa       120
     ggtagtatca cttctcagcc agttgcagtt atgtgtgcac gtgctaatct gtacagttcg       180
     acgatacaga agtcaagcct gggtgcttgc atatagctga ggtactgaca tcgtggtttg       240
     gaccttgata gatttacaaa gccgcacagt gttgcacgaa ggcgtatgta ggactataat       300
     tagagttcaa acgccctaac gtcaatggcc atcggaatgc ttcacagtac cctctgaggt       360
     aataaatgag tcaaaaatta ctaaaagcat gataggcgct gcgaatcctt gcttgggtgc       420
     attatctcga gagaattctt gtatttatgg ggctgacacc acgatgacgg tattgatgtg       480
     aaattaactt aatctataca ccacacctat tatggaaaaa cttttcgttc atcagtgtat       540
     ttaattctca cctttaaatg catggttcag gttgataaag ggttcgcgat ctcctgaaag       600
     tcctgaaaga tgtttattcg tcggttgcat accagttcgc gaaggttaac atgcggcgag       660
     gctcttcgtg cgtgccagca aacaggcgct agaagtgcta atggccagct gatgctgtcg       720
     cagcatgtac aggaattcga cccggagatg tacgatatat taactaagga acgctcaaga       780
     cagaagcgta gtatcacttt gattccaagc gagaacttca catcagtggc tgttatgaac       840
     ttgctcggaa gtgaaatgca aaacaagtac tcggaaaggt atccgggtca gcggtattat       900
     gggggtaacc agtacatcga tatggcagag tccctgtgcc aaaagcgcgc tctggagcta       960
     tatgggctag atcccgccaa atggggcgtc aatgtacagt cattgtccgg agcaccagcg      1020
     aacctctatg cttactcagc cattatggag gttggcgatc gcatgatggg tctagatctt      1080
     cctcacggtg gccatctgtc ccacggttac cagctacaaa atggaaacaa aatttcgtac      1140
     atctccaagt acttccagac catggcgtac cgtgtggacc ctgccacagg cttggtcgac      1200
     tatgataccc tgtctgagac ctcgaaactc ttcagaccta aggtgattgt tgctggtaca      1260
     tcagcatatg cgcgggtcct ggattataag cggtttaggg agattgccga tgcctgtggc      1320
     gcgtatctcc tctctgatat ggcgcatgtt tctggtttgg ttgcagctgg tgtgcaccca      1380
     tctcccttcg agtactccga cattgtcacc actaccacac acaaatccct aagaggacca      1440
     agaggtgcca tgattttcta ccggaaaggc attagaaagg tgaccaagaa gggaaccgag      1500
     atcatgtatg acttggacaa gcgcatcaac ttctcggttt tcccagctca ccagggcggg      1560
     ccacataacc ataccatttc cgcacttgcc gtcgcgttga agcaggctgc tactccagag      1620
     ttcaagaact atcaaaccgc tgtggtagag aatgccaaag tttttggcga agaactaagt      1680
     aagcgtggct ttagtcttgt ctccggagga actgatacac atctgctatt gatcgacttg      1740
     tcccccatgg gcattgacgg gtctaggctt gaaactatac tggaacgact aaatattgcg      1800
     gccaacaaga acaccatccc aggcgacaag tccgctctat atccttctgg cctgagagtc      1860
     ggtacgcctg caatgaccac ccgtgggttt ggcccggccg aatttggccg ggttgcagcg      1920
     tatatcaacg aggctgttaa actggcaatt ggcttaaagt cacaagagcc agtagacgct      1980
     aaggacgcca agaccaggtt ggctcacttc aaaagttttt gcgcagaatc ggaacaggta      2040
     accaagctgg ccaacgaggt ggcagactgg gttgcacagt accctgtgcc aggagaattg      2100
     taaataacgt acttaataac caatgtcccg gtctttgtga agctaccgtt gtctacgccc      2160
     gtcgcccgcc tccccctggc ctagcacctg caaccgtggt ctgcagcacc tggcgccaag      2220
     ttntttcaca atgntgcgct ggggtgactc ctgaggctcc gcctggagca aaaaacgctc      2280
     cggttttacg tgcttancna ngtccatgca acagttcctc gatnncctcn cccgtcttgg      2340
     ccgacacana cgttcncttg gcagtggtgt gntccaactg cnccccccgc nnngcaggtc      2400
     aatcttgttg gaccacgatc cgcaccacca catcgtttcg ttgtgcctcc ccaatgtatg      2460
     tattcagctc gtctatccac gaccgtgcgt tctgaaagct ctgttgctcg gtcacatcgt      2520
     acacaactag cgctacgtcc gtgtttcgat agtacattgg tgccagtgac cggtaccgct      2580
     cctggcctgc agtatcccat atctcaaacg tgacgctgcg cacttctttt gcgtcactgc      2640
     cgtcacccgc gtcctcttcc cattggactg acctcgtagt gaacgcngct cctatcgtcg      2700
     cctggttctt ccggaactcg cccgtcgtga atcgcgttac aatcgatgac ttgcccactg      2760
     aaaactcacc taacagcacc agcttgacct ggcagcagta atgtctggcc atgactccta      2820
     acggtctttt tgtttga                                                     2837
//

If you have problems or comments...

PBIL Back to PBIL home page