(data stored in ACNUC9552 zone)

EMBL: AJ495801

ID   AJ495801; SV 1; linear; genomic DNA; STD; ROD; 1019 BP.
XX
AC   AJ495801;
XX
DT   07-JAN-2005 (Rel. 82, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 3)
XX
DE   Rattus norvegicus partial bcl-X gene for B cell lymphoma like X, exons 1-2
XX
KW   B cell lymphoma like X; bcl-X gene.
XX
OS   Rattus norvegicus (Norway rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Rattus.
XX
RN   [1]
RP   1-1019
RA   Valks D.M.;
RT   ;
RL   Submitted (12-JUL-2002) to the INSDC.
RL   Valks D.M., Cellular and Molecular Biology, Imperial College, SAF Building,
RL   Exhibition Rd, South Kensington, London, SW7 2AZ, UNITED KINGDOM.
XX
RN   [2]
RA   Valks D.M., Sugden P.H., Kemp T.J., Clerk A.;
RT   "Regulation of the Bcl-X gene by alternative promoters in neonatal cardiac
RT   myocytes";
RL   Unpublished.
XX
RN   [3]
RA   Valks D.M.;
RT   "Regulation of Bcl-2 family proteins in neonatal cardiac myocytes in
RT   response to oxidative stress";
RL   Thesis (2003), Department of Cellular and Molecular Biology, Imperial
RL   College of Science Technology and Medicine, London, United Kingdom.
XX
DR   MD5; bc3a89ecfe4fd00e840749254b9158a6.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1019
FT                   /organism="Rattus norvegicus"
FT                   /strain="Sprague Dawley"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="heart"
FT                   /db_xref="taxon:10116"
FT   mRNA            join(<120..451,701..>1019)
FT                   /gene="bcl-X"
FT   exon            <120..451
FT                   /gene="bcl-X"
FT                   /number=1
FT   intron          452..700
FT                   /gene="bcl-X"
FT                   /number=1
FT   regulatory      667..673
FT                   /gene="bcl-X"
FT                   /regulatory_class="TATA_box"
FT   exon            701..>1019
FT                   /gene="bcl-X"
FT                   /number=2
FT   CDS_pept        813..>1019
FT                   /gene="bcl-X"
FT                   /product="B cell lymphoma like X"
FT                   /function="cytoprotective"
FT                   /db_xref="GOA:Q5K547"
FT                   /db_xref="InterPro:IPR003093"
FT                   /db_xref="InterPro:IPR013279"
FT                   /db_xref="InterPro:IPR020731"
FT                   /db_xref="InterPro:IPR026298"
FT                   /db_xref="InterPro:IPR036834"
FT                   /db_xref="UniProtKB/TrEMBL:Q5K547"
FT                   /protein_id="CAD42238.1"
FT                   /translation="MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEETEPER
FT                   ETPSAINGNPSWHLADSPAVNGAT"
XX
SQ   Sequence 1019 BP; 255 A; 235 C; 308 G; 221 T; 0 other;
     ggagccgttt acggtttcgg cagcctcatc ccgggctggt acttaaatag aaagaaagaa        60
     aggaggggtg gggggaaatt acactaaacc catacctccg ggagagttct cctggctccc       120
     agtaggaggc gagagccaag gggcgtgcta gagcgagggg gttgggctcc cgggtggctg       180
     gaggctgcgg agcagagagg ccgccctcga tctgggcgat ggaggaagca agcgaggggg       240
     caggttccta agcttcgcaa ttcctctggc ctgcctacca ggtcgcatga tcccggccgg       300
     gaccggggtt ttttgctgag ttaccggcga cccagccacc acctcctccc gacctatgat       360
     acaaaagacc ttccgggggc tgcacctgct ctctgtcgcc ggagatagat ttgaatgtag       420
     gtggtggtgg gtggggatgt gccaatgggg gtgacttttg gagaaaggcg tttcggagaa       480
     aagggggtgg gtggttgtag taaaaagagg ctgatgaaac aattcaaagc ttgctggtcc       540
     tttcaatttg acttcattga agtctcttag aacctggact cagaccttca taagagccac       600
     aaagaaacca attctggtaa ctgggggagg aatggggatt ttgtaaggta aatgacatgc       660
     attaaaaaat tttctcctga agctctttct ctctcttcag aaccctatct tggctttgga       720
     tcctggaaga gaatcgctaa acacagagca gacccagtga gtgagcaggt gttttggaca       780
     atggactggt tgagccctac tctatttata aaatgtctca gagcaaccgg gagctggtgg       840
     ttgactttct ctcctacaag ctctcccaga aaggatacag ctggagtcag tttagcgatg       900
     tcgaagagaa caggactgaa gccccagaag aaactgaacc agaaagggag acccccagtg       960
     ccatcaatgg caacccatcc tggcacctgg cggatagccc cgcggtgaat ggagccaca       1019
//

If you have problems or comments...

PBIL Back to PBIL home page