(data stored in ACNUC8465 zone)

EMBL: AJ508668

ID   AJ508668; SV 1; linear; mRNA; STD; INV; 718 BP.
XX
AC   AJ508668;
XX
DT   20-MAY-2003 (Rel. 75, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   Ciona intestinalis mRNA for Rac2 protein
XX
KW   Rac2 protein; small monomeric GTPase.
XX
OS   Ciona intestinalis
OC   Eukaryota; Metazoa; Chordata; Tunicata; Ascidiacea; Enterogona;
OC   Phlebobranchia; Cionidae; Ciona.
XX
RN   [1]
RP   1-718
RA   Fort P.P.;
RT   ;
RL   Submitted (20-SEP-2002) to the INSDC.
RL   Fort P.P., CRBM-UPR1086, Cnrs, 1919 route de Mende, 34293 Montpellier CEDEX
RL   5, FRANCE.
XX
RN   [2]
RX   DOI; 10.1016/S0248-4900(03)00052-2.
RX   PUBMED; 12941527.
RA   Weill M., Blein M., Robert A., Chambon J.P., Baghdiguian S., Weill M.,
RA   Fort P.;
RT   "Ascidians as a vertebrate-like model organism for physiological studies of
RT   Rho GTPase signaling";
RL   Biol. Cell 95(5):295-302(2003).
XX
DR   MD5; 4e734dd509af348ca3ffa5ea752687c2.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..718
FT                   /organism="Ciona intestinalis"
FT                   /mol_type="mRNA"
FT                   /dev_stage="embryo"
FT                   /tissue_type="mixed tissue"
FT                   /db_xref="taxon:7719"
FT   CDS_pept        6..584
FT                   /product="Rac2 protein"
FT                   /function="putative role in cell morphology control"
FT                   /EC_number="3.6.1.47"
FT                   /db_xref="GOA:Q7YT78"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003578"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7YT78"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="CAD48475.1"
FT                   /translation="MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVM
FT                   VDGRPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSVASPASYENVRAKWHPEVAHH
FT                   CPETPVLLVGTKLDLRDDADTVNKLAEKKLSTITTTQGLQMAKELGAVKYQECSALTQK
FT                   GLKNVFDEAIRAVLNPTRRVVRTKNCEIL"
XX
SQ   Sequence 718 BP; 195 A; 163 C; 167 G; 193 T; 0 other;
     aagatatgca agcgataaag tgcgttgtgg ttggagatgg agctgttggt aaaacctgtt        60
     tgctgatcag ctacacaact aacgctttcc ctggagaata tattcccact gtgtttgata       120
     actactctgc caatgtcatg gtagatggcc gccctgtcaa cttgggatta tgggatacag       180
     caggacagga ggattatgac agactccgac ctctctccta cccacaaacc gatgtttttc       240
     tcatttgttt ctctgtggct tctcccgctt cctacgaaaa cgtgcgcgca aagtggcacc       300
     cggaggtcgc acaccactgc ccggaaacgc ccgtacttct cgtgggaaca aaacttgatt       360
     tacgtgacga tgcggacact gtgaacaagc tagctgagaa aaagctctcc accattacta       420
     ctacccaagg tttacaaatg gcgaaggaac tgggggcggt taaataccaa gagtgctctg       480
     ctctgacgca aaaggggctg aaaaatgttt tcgacgaagc gattcgggcg gttcttaacc       540
     caacaagaag agtcgtccga acgaagaact gcgaaattct atgattacat tgacatgtag       600
     agcggcctcg aacgtttaca ataatttgga attatgttcc tatttaataa atggagttcg       660
     gtggctttat atattctctc ttatcgtttt aagcatttta aaatcgtcgc taccgtgt         718
//

If you have problems or comments...

PBIL Back to PBIL home page