(data stored in ACNUC17492 zone)

EMBL: AJ549925

ID   AJ549925; SV 1; linear; mRNA; STD; MAM; 2078 BP.
XX
AC   AJ549925;
XX
DT   13-MAR-2003 (Rel. 75, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Sus scrofa mRNA for regulator of G-protein signalling 5 (RGS5 gene)
XX
KW   regulator of G-protein signalling 5; RGS5 gene.
XX
OS   Sus scrofa (pig)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Laurasiatheria; Artiodactyla; Suina; Suidae; Sus.
XX
RN   [1]
RP   1-2078
RA   Weiss B.;
RT   ;
RL   Submitted (12-MAR-2003) to the INSDC.
RL   Weiss B., Vascular-Genomics, Kerckhoff-Klinik, Benekestrasse 2-8, 61231 Bad
RL   Nauheim, GERMANY.
XX
RN   [2]
RA   Weiss B., Hehlgans S.I., Wietelmann A.B., Zeyer A., Richter M.,
RA   Kloevekorn W.P., Zimmermann R., von der Ahe D.;
RT   "Differential gene expression in atherosclerotic coronary arteries";
RL   Unpublished.
XX
DR   MD5; b48a29404a75e3a7771f97b318177e89.
DR   Ensembl-Gn; ENSSSCG00000037821; sus_scrofa.
DR   Ensembl-Gn; ENSSSCG00070024889; sus_scrofa_usmarc.
DR   Ensembl-Tr; ENSSSCT00000041659; sus_scrofa.
DR   Ensembl-Tr; ENSSSCT00070049761; sus_scrofa_usmarc.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2078
FT                   /organism="Sus scrofa"
FT                   /mol_type="mRNA"
FT                   /tissue_type="aorta"
FT                   /db_xref="taxon:9823"
FT   CDS_pept        82..627
FT                   /gene="RGS5"
FT                   /product="regulator of G-protein signalling 5"
FT                   /function="inhibits signal transduction"
FT                   /db_xref="GOA:Q864Z2"
FT                   /db_xref="InterPro:IPR016137"
FT                   /db_xref="InterPro:IPR024066"
FT                   /db_xref="InterPro:IPR034955"
FT                   /db_xref="InterPro:IPR034956"
FT                   /db_xref="InterPro:IPR036305"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q864Z2"
FT                   /protein_id="CAD71257.1"
FT                   /translation="MCKGLAALPHSCLERAKEIKIKLGILLQKPESAVDLVIPYNEKPD
FT                   KPVKIQKPSLDEALQWRDSLDKLLQNNYGLASFKSFLKSEFSEENLEFWMACEDYKKIK
FT                   SPVKMAEKAKKIYEEFIQSEAPKEVNIDHFTKEITMKNLVEPSPSSFDVAQKRIYALME
FT                   KDSLPRFVRSEFYQEFIK"
XX
SQ   Sequence 2078 BP; 649 A; 405 C; 388 G; 635 T; 1 other;
     agaccatttt gaagttttca aagacttgct ctgctgataa ggacttgtgc tcaaacctga        60
     gggactaagc cacttgccaa aatgtgcaaa ggacttgcag ccttgcccca ctcatgcctg       120
     gaaagggcca aggaaattaa gatcaagttg ggaattctcc tccaaaagcc ggagtctgct       180
     gttgaccttg tcattccgta caatgagaag ccggacaagc cagtcaagat ccagaaaccc       240
     tcactggatg aggccctgca gtggcgtgat tccctggaca agctcctgca gaacaactat       300
     ggacttgcca gcttcaaaag tttcctgaag tctgaattca gtgaggaaaa ccttgagttc       360
     tggatggcct gtgaggacta caagaagatc aagtccccag tcaagatggc agaaaaagca       420
     aagaagattt atgaagaatt catccagtcg gaggctccta aagaggtgaa tattgaccac       480
     ttcacgaagg agatcacaat gaagaacctg gtggaacctt ccccaagcag ctttgatgtg       540
     gcccagaaaa gaatctatgc cctgatggaa aaggattcac tgcctcgctt cgtgcgctct       600
     gagttttatc aggagttcat caagtagcga ttcagttggg ctgtgagaaa catcctgagt       660
     gttatttcct ccataataac cctacctttc ccagcaactc acatatcttc ctctagcagc       720
     ttgctcaaag attctcaaat ggaaagtccc agggagtggt gcttactctt ttgcccacat       780
     tgtcttggat gtgtaatcta ttacccaaat caaatccctt ccttatccag tttccttttc       840
     ctgttcccat tcttaattac actctactct tgtatgttgt tgtaaaactc aattagaaag       900
     acagaaaaac tctacctgag gaaacataag acaggaatat gataccactg aatatgggtc       960
     tgttggattt agataatgga tctcccccta aactgatatg aaaaagaata tggatgtgga      1020
     aagaccagtt tcaggtgaga tgaactgatc tcatttgttg ttttaattct gatccaagtg      1080
     tgtgtgtgtg ggggggtcac tcctctcatc tccgaacttg gccagtaaaa ggcagtaaga      1140
     atttcatgag gcagcactat ttgatttttg aagcaaatat atagtttata aattgatttt      1200
     cctctgagag catctttgtg ctaattggag actataaaca agagatacat ccatgaatat      1260
     attttgttta tacaaagtcc atctgaaccc agtccatatg gtttctttcc tttcacttcc      1320
     cgtgtacatc cccaggcata aagttaccaa atttggtatt aaatcaatat tttataaatg      1380
     catctatgcc tctattatgt aggcctacaa tgtcagtttt taaagtattt aaaatctgta      1440
     tgagtgtaaa attccaaaat ttttcatttc aatcatctaa aataaaagct actcctatcg      1500
     caatgctctc ccacctcaat attaagaggg ctgtacacta aaatggggaa atcttgttaa      1560
     gcctaaaatg gttagttgtc ctatgatgcc atctgtttgt taagtaaatg attattgtct      1620
     tcaaactatt tcagaaaagt taatttgatt aaatgcagag actcyccaac tgggatagag      1680
     ttttaaagta ccctgcattt tgcaaaataa tgtgatcttt tagcaactcc gagttccttc      1740
     cctatttcgc ttgctgcatt actgagctgt attcatagcc aaaatgcact tttatacccc      1800
     taatatgcct tacacactgt cgattgatag gccatggtaa attttttagt aggtttaaac      1860
     ttttaattct gtatttcatt attataagtc ttgctagatt tttttttgca tatctttata      1920
     ttttattaag caataattta cataatctag tgatgaagag actcaaacta tgtatgaggg      1980
     caaccaaagt gaggatactg agttaaaaac gtattttgaa aggattaata aaaatctgaa      2040
     atgtttaagt aaaaaaaaaa aaaagaaaaa aaaaaaaa                              2078
//

If you have problems or comments...

PBIL Back to PBIL home page