(data stored in ACNUC27125 zone)

EMBL: AJ584614

ID   AJ584614; SV 1; linear; mRNA; STD; MAM; 764 BP.
XX
AC   AJ584614;
XX
DT   01-OCT-2003 (Rel. 77, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Sus scrofa partial mRNA for Calcineurin A protein
XX
KW   CALCINEURIN A gene; Calcineurin A protein.
XX
OS   Sus scrofa (pig)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Laurasiatheria; Artiodactyla; Suina; Suidae; Sus.
XX
RN   [1]
RP   1-764
RA   Hopwood P.A.;
RT   ;
RL   Submitted (30-SEP-2003) to the INSDC.
RL   Hopwood P.A., Preclinical Veterinary Sciences, Royal School for Veterinary
RL   Studies, Summerhall, Edinburgh, EH9 1QH, UNITED KINGDOM.
XX
RN   [2]
RA   Hopwood P.A., Zhang F., Lowden S., Talbot R., Burt D., Archibald A.,
RA   Dixon L.;
RT   "Development of a porcine cDNA microarray";
RL   Unpublished.
XX
DR   MD5; c854910c2fc99079c81b6a7bb8a593fa.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..764
FT                   /organism="Sus scrofa"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9823"
FT   CDS_pept        <1..>764
FT                   /codon_start=2
FT                   /gene="CALCINEURIN A"
FT                   /product="Calcineurin A protein"
FT                   /db_xref="GOA:Q70EE9"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q70EE9"
FT                   /protein_id="CAE47804.1"
FT                   /translation="NHECRHLTEYFTFKQECKIKYSERVYEACMEAFDSLPLAALLNQQ
FT                   FLCVHGGLSPEIHTLDDIRRLDRFKEPPAFGPMCDLLWSDPSEDFGNEKSQEHFSHNTV
FT                   RGCSYFYNYPAVCEFLQNNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYL
FT                   DVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLSI
FT                   CSDDELMTEGEDQFDGSAAARKELYEQIRAIG"
XX
SQ   Sequence 764 BP; 249 A; 129 C; 142 G; 244 T; 0 other;
     caaccatgaa tgcagacacc ttactgaata ttttaccttt aaacaggaat gtaaaattaa        60
     atattcagaa agagtctatg aagcttgtat ggaagctttt gatagcctcc ctcttgctgc       120
     acttttaaat caacaatttc tttgtgttca tggtggactt tcaccagaaa tacacacact       180
     ggatgatatt agaagattag atagattcaa agagccacct gcatttggac caatgtgtga       240
     cttgctatgg tctgatcctt ctgaagattt tggaaatgaa aaatcacagg aacattttag       300
     tcacaataca gttcgaggat gttcttattt ttataactat ccagcagtgt gtgaattttt       360
     gcaaaacaat aatttgttat cgattattag agctcatgaa gctcaagatg caggctatag       420
     aatgtacaga aaaagtcaaa ctacagggtt cccttcatta ataacaattt tttcggcacc       480
     taattactta gatgtctaca ataataaagc tgctgtatta aagtatgaaa ataatgtgat       540
     gaatattcga caatttaact gttctccaca tccttactgg ttgcccaatt ttatggatgt       600
     cttcacctgg tctttaccat ttgttggaga aaaagtgaca gaaatgttgg taaatgttct       660
     cagtatttgc tctgatgatg aactgatgac tgaaggtgaa gaccagtttg atggttcagc       720
     tgcagcccgg aaagaattat acgaacaaat tcgagcaatt ggca                        764
//

If you have problems or comments...

PBIL Back to PBIL home page