(data stored in ACNUC31183 zone)

EMBL: AJ628446

ID   AJ628446; SV 1; linear; mRNA; STD; HUM; 6682 BP.
XX
AC   AJ628446;
XX
DT   01-SEP-2004 (Rel. 81, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Homo sapiens mRNA for Rap1 GTPase activating protein 2b (RAP1GA2 gene)
XX
KW   Rap1 GTPase activating protein 2b; RAP1GA2 gene.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-6682
RA   Schultess J.;
RT   ;
RL   Submitted (23-FEB-2004) to the INSDC.
RL   Schultess J., II, Institute for Biochemistry, Theodor-Stern-Kai 7,
RL   Frankfurt/Main, 60590, GERMANY.
XX
RN   [2]
RX   DOI; 10.1182/blood-2004-09-3605.
RX   PUBMED; 15632203.
RA   Schultess J., Danielewski O., Smolenski A.;
RT   "Rap1GAP2 is a new GTPase-activating protein of Rap1 expressed in human
RT   platelets";
RL   Blood 105(8):3185-3192(2005).
XX
DR   MD5; 50c125b59665a2f77d1b02c61388cdc9.
DR   Ensembl-Gn; ENSG00000132359; homo_sapiens.
DR   Ensembl-Tr; ENST00000254695; homo_sapiens.
DR   Ensembl-Tr; ENST00000366401; homo_sapiens.
DR   Ensembl-Tr; ENST00000540393; homo_sapiens.
DR   Ensembl-Tr; ENST00000542807; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..6682
FT                   /organism="Homo sapiens"
FT                   /chromosome="17"
FT                   /map="17p13.3"
FT                   /mol_type="mRNA"
FT                   /country="Germany"
FT                   /cell_type="platelets"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        91..2283
FT                   /gene="RAP1GA2"
FT                   /product="Rap1 GTPase activating protein 2b"
FT                   /db_xref="GOA:Q684P5"
FT                   /db_xref="H-InvDB:HIT000249324_01.9"
FT                   /db_xref="HGNC:HGNC:29176"
FT                   /db_xref="InterPro:IPR000331"
FT                   /db_xref="InterPro:IPR035974"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q684P5"
FT                   /protein_id="CAF31652.1"
FT                   /translation="MFGRKRSVSFGGFGWIDKTMLASLKVKKQELANSSDATLPDRPLS
FT                   PPLTAPPTMKSSEFFEMLEKMQGIKLEEQKPGPQKNKDDYIPYPSIDEVVEKGGPYPQV
FT                   ILPQFGGYWIEDPENVGTPTSLGSSICEEEEEDNLSPNTFGYKLECKGEARAYRRHFLG
FT                   KDHLNFYCTGSSLGNLILSVKCEEAEGIEYLRVILRSKLKTVHERIPLAGLSKLPSVPQ
FT                   IAKAFCDDAVGLRFNPVLYPKASQMIVSYDEHEVNNTFKFGVIYQKARQTLEEELFGNN
FT                   EESPAFKEFLDLLGDTITLQDFNGFRGGLDVTHGQTGVESVYTTFRDREIMFHVSTKLP
FT                   FTDGDAQQLQRKRHIGNDIVAIIFQEENTPFVPDMIASNFLHAYIVVQVETPGTETPSY
FT                   KVSVTAREDVPTFGPPLPSPPVFQKGPEFREFLLTKLTNAENACCKSDKFAKLEDRTRA
FT                   ALLDNLHDELHAHTQAMLGLGPEEDKFENGGHGGFLESFKRAIRVRSHSMETMVGGQKK
FT                   SHSGGIPGSLSGGISHNSMEVTKTTFSPPVVAATVKNQSRSPIKRRSGLFPRLHTGSEG
FT                   QGDSRARCDSTSSTPKTPDGGHSSQEIKSETSSNPSSPEICPNKEKPFMKLKENGRAIS
FT                   RSSSSTSSVSSTAGEGEAMEEGDSGGSQPSTTSPFKQEVFVYSPSPSSESPSLGAAATP
FT                   IIMSRSPTDAKSRNSPRSNLKFRFDKLSHASSGAGH"
FT   regulatory      6648..6652
FT                   /gene="RAP1GA2"
FT                   /regulatory_class="polyA_signal_sequence"
XX
SQ   Sequence 6682 BP; 1441 A; 1869 C; 1863 G; 1509 T; 0 other;
     actgaccccg ctgtaccacg gccctcttgc ggacagcccc ggggacgtcg ttgggacatc        60
     gctgggaccc cgggctctgc agccacaacc atgtttggcc ggaagcgcag tgtctccttt       120
     gggggcttcg gatggatcga caagaccatg ctggcaagtc tgaaggtcaa gaagcaggag       180
     ctggccaaca gctcggatgc gaccctccca gaccggccgc tctcccctcc tctcacggca       240
     cctcccacca tgaagtcgtc ggagttcttt gagatgctgg agaaaatgca ggggatcaag       300
     cttgaagagc agaagccggg accccagaag aacaaggacg actatatccc ataccccagc       360
     atcgacgagg ttgtggagaa gggaggcccg taccctcagg tcatcctgcc acagtttggg       420
     ggctattgga tcgaggaccc ggagaacgtg ggcaccccaa catcgctggg gagcagcatc       480
     tgtgaggagg aggaagagga caacctcagc cccaacacat ttggctacaa gctcgagtgc       540
     aagggtgaag ccagggccta ccggaggcac ttcctgggga aggatcatct aaacttttac       600
     tgtaccggca gcagcctggg gaacttgatc ctgtccgtca agtgcgagga agcagagggg       660
     atcgagtacc tccgggtcat cctcaggtcc aaactgaaga cggtacatga gcggatcccc       720
     ttggctggac tgagcaagct tcccagtgtc cctcagattg caaaggcttt ctgtgatgat       780
     gcagtgggac tgagattcaa tcctgtcctg taccccaagg cctcccaaat gattgtgtcc       840
     tatgatgagc atgaagtcaa caacacattc aaattcggag tcatttatca aaaagccagg       900
     cagaccctgg aggaggagct atttgggaac aatgaggaga gcccagcttt taaggagttc       960
     ttggacctgc tgggggacac gatcacactg caggatttca atggtttccg aggaggcctg      1020
     gacgtgaccc acggacagac aggggtggaa tcagtgtaca caacattccg ggacagggag      1080
     atcatgtttc acgtttccac aaagctgcca tttaccgacg gagacgccca gcagctccag      1140
     agaaagagac acattggaaa tgacatcgtg gccatcatct tccaagagga aaacacgccg      1200
     tttgtcccag acatgatagc ctccaatttc ttacatgcct acatcgtcgt gcaggtcgag      1260
     accccaggca cagagacccc atcctacaag gtctctgtca ctgcgcggga agatgtgccc      1320
     acctttggtc cacctctgcc cagtcccccc gttttccaga agggcccgga attcagggag      1380
     tttctgctca ccaagctcac caatgccgag aacgcctgct gcaagtcgga caagtttgca      1440
     aagctggagg accggaccag ggctgccctc ctggacaacc ttcacgatga gctccacgcc      1500
     cacacacagg ccatgctggg actgggccca gaggaggaca agtttgagaa tggaggccac      1560
     ggggggttcc tggagtcttt taagagggcc atccgcgtac gcagccactc catggagacc      1620
     atggtgggcg gccagaagaa gtcgcacagt gggggcatcc ctggcagcct cagcgggggc      1680
     atctcccaca acagcatgga ggtcaccaag accaccttct cgcctccagt ggtggcggca      1740
     acggtgaaga accagtcacg gagtcccatc aagcgacgct cggggctctt cccccgcctg      1800
     cacacgggct cagaaggcca gggcgacagc cgggcacgat gtgacagcac atccagcaca      1860
     cccaagaccc cagatggtgg acactcctct caggagataa agtctgagac ctcatccaat      1920
     cccagctctc cagaaatctg ccccaacaag gagaagccct tcatgaagtt gaaggaaaac      1980
     ggccgcgcca tctcccgctc ctcctccagc accagcagcg tcagcagcac tgcaggggag      2040
     ggcgaggcca tggaggaggg cgacagtggg ggcagccagc cgtccacgac ctcacccttc      2100
     aagcaggagg tgtttgtcta cagcccgtcc ccgagcagcg agagccccag cctgggggca      2160
     gctgccaccc caatcatcat gagccggagt cccacagatg ccaaaagcag aaactccccg      2220
     agatcgaacc tgaaattccg ctttgacaag ctcagccatg ccagctctgg tgcgggtcac      2280
     taatgtgaaa gtggagtcct tcgcctgtcc aagggaatcc cctcttctgt cctggaaaag      2340
     gctcctgtac cagcagtttg ggagtgccgt ccacgaccct gacagtccca gccctgctgc      2400
     cccatggcca cgtgcccaca gatgtgctgt tggtccaggt gtcccagtct ggccacagcc      2460
     ctgcctccgc cctcacctac atgccctccc agcccctccc atctctggac gaggcctcct      2520
     tcctcaggtt cctcctgctc ctgacctccc agtgtgatgt ccgggtcctt tatcatccta      2580
     ttcatcctgg agaggaaaag tgtcgggcaa agggggatct ggggggagct cagcagtgac      2640
     tggggagctg gtctgcctca gagacagagt agggggtggg agcagagcct cggtgagggt      2700
     cttggccaca gggcagtgcc ttcctgaacg tggcaggctt tactaccagg aacgcactcg      2760
     gtggtggagg ccccatgttc ccaggagcca agattcgtag catccttgag gccatcctga      2820
     taaaattcgg cgctattgcc cccgtagctc tggagctcta aaccgtctat ctgcttctgt      2880
     gctgaacgcc tttcccatct gctgacgtag gcccagggct gccctgcccc tgctgccagt      2940
     gtaccgtgag cggggctcca gccagttcaa gctcagagcc agagctggac gggccagaac      3000
     tgcgctgcac acttcctgga ctgaggcggg gactttgggt cccacccggt ttctcctgat      3060
     tatggctgct gtggggtgag gggagggagg ggcagccccg aggcagtctc ttccctttga      3120
     gaagatattt tcccacaaag gggtgggaag ccaggagtga gaaggaattc agggagagca      3180
     aaggagccag tgctgagatg ctgctgtgtt ggttgaggaa aacctcgggc ctgagggcca      3240
     ggccggagcc caggtctctg ctgacaatgg gggttcaagg aagacgtcgt tatctcccct      3300
     ccccacttac tcgaggagag aggtgagggg gggatgactt gcgggttctg atcaggcccc      3360
     tgggtgggga aggggcacag tgtccctcag cagcttacgc ccctggagtc ttggggggcc      3420
     cagcctggcc ctggggcctt ttccagctac tgtgcccttg ggtagctgcg tctggggctc      3480
     aaccccccaa tcctgttccc ctctccagct gcgggtctgt aggcagctgt cacatctgaa      3540
     gggtttctgc aacctggacc ccatctgggt gtgggtcaga ctctgtgacc cacatgccac      3600
     ccccaccctc cacagagccc ccttgctggg acagccagct cacctccaag gacatcccct      3660
     cctggcttct cccccttccg agtctgcagc gccgtgggct tctctgccga tgggcccggg      3720
     ttggggttaa ggtgggcatc ctccaggtac aacgagcctg aagagcccct ttcagtgcag      3780
     acggggctgc agagtgacac tggctgggca cctgccccac gaccaatgac aaggatttcc      3840
     agctgaatgc tttattccca tagggatctg gacctgtgcc caagatataa atactacact      3900
     tttttttttt tttttttttt aactgacatt gtgaaattct ccctatagct tttgccattc      3960
     aagcaacatt gtgatctttc ttccccgcca cgtgtgtggg aatgattgag tcctgtttgc      4020
     aagctggaga ggagctctcc cttcgctagt actttctcta aagtactagt ctagtaaaat      4080
     ttattcttgt tagaaggtca acaaaatatc tgtttagctt ttatgaagag tcaccgtagc      4140
     agcccccacg gctggaaaga ggcccgtacg ttctggacgc gttttgttgg ctgggcttct      4200
     ggaggcactg gcaaggtcaa actgcatttc tttaagaaca gttgcaggat ctggcttgcc      4260
     tctgtgggaa gccggcatta caggtgcttg gtggatgggc cgtgtcacat tgccatctgg      4320
     ggtcctttgg ggtttccagg ttgtcagcat gctgtcccat ttgggaatcc catacctgcc      4380
     tgtccccact gcgctggctg acccttgctg cctgctgcct cttgggaggg ctttgtccct      4440
     tgcctctgag ctggtgggca ggatggctgg gtggccccca gagaagcaca gacctgggat      4500
     ggggtctcca tgcccggttt gctgttggaa tgatctgaac aggaccccaa atgcctcttc      4560
     cctctggtca tgcctcacta tctctaggag ctccatcctg tggcttccag agtgtgcact      4620
     tccagcccac ccgggcagtg ctgagaggga ggaggagaac aaggatggcc cagcctcccc      4680
     tccctcccct agaccacggg gcgggcagct cgggttcctg gagggctgtt tcccccacgc      4740
     tgtccctaca tctgctctga tctaaaatgt ctttcctttt atgctgcgcc cagtcttggg      4800
     gctcaaagat ttgcccaaac ctcattggcc ctcgtgacta ggctcatcta gatggtgctc      4860
     acgctggtgt ttgaggcatt tccactgtga tctccacgag gggatgtttt ccgggacaca      4920
     tctctggctc tgggaactgc ctgactcact gaagaaacta cttttcaggc actgtagggt      4980
     cacccatatg cctccagctc agttgacgct taaaaacagg tgcagaaaag ctcgcgatgg      5040
     aaggtcttaa tgagagtgtc tgtctatgcc agtcatgtaa aatgacgttt cttgaaaaag      5100
     attcagtggt tcagctttgt cagcatcatc tcaacacaag cctgctggct ctttttagca      5160
     tctcatccaa ccatgtcatc gtccagatga gaaatcttag cccaggtgag gggaataact      5220
     tgcttgaggt cacacagctg gctgttggca aagctgggat tagaaccctc aacccagggt      5280
     cccttcctct gcagcgccta catggttggt tgaataagtg gctgcgtttc ctggggccct      5340
     gggttttggg gaagccagtt agctgctgct ttggcactgg catggaggtg agcagtcaag      5400
     gatgctggtg aggccgcagt ttctgctctt tttcatcagg ggggatagtc tctaggattt      5460
     ttcagtgagg acccttgggc tttggatgca gcttgaacca agaaaacgag gagggaaagg      5520
     gattcagtga actattcctc agtgggatcg gttcttcagc tcctgatggg ggctgtgtaa      5580
     tgggggcaga ggccagggaa aaagatgctg ttcacccacc ctcagcttcc cttttcctaa      5640
     attaagagga aaagtggtca aagaaaaact cttcatttct ccctgattct taagcgaagg      5700
     tggttaatag aaactcaggc tcccgtgaca aggcaggaca agagcctgtt tcgctttcct      5760
     ccctgaccct gccaggtgcc aactcaaaca ctacctttct cattggtttc taagtcagta      5820
     gagacagatc tgttttaagc agttgggggt tcgagtagat ctcatgggta caggaggcca      5880
     gcagggacca ggccagtcag ccatgctcag gacccctcgg ctcctccccc agcctctagc      5940
     taccctgtat cgaggcaagg ggaggccagt aaagtttgcc aagcctgatc ctgcagcctg      6000
     gtggggctgg ctggggtatt cttttaccaa actctgtttt accgccagcc ccttgtacac      6060
     cccaatccca tgtctccctc ccttcagctg gaccgtgtgc ccctttggga ggaagaagac      6120
     aagcgccact agggccaagg gcagcagagc cctgccgagt gagaggctgt ggggcagcgg      6180
     ctctgtcctg tgccttacca gccctgggga gggggacatt tggctggaag actggaattt      6240
     aattgccatc gtctttgatt ttgtgacatt tctgcttgga agtgtgaact accctccccc      6300
     ccccgcttcc tgctccttag catgcgtgca gctctctcct gttttgggtg ttacccttgg      6360
     acactccagc tcggggactg ctggcgtgtg agtgtgcaga ttcccctgtg tggtcgaacc      6420
     taagaactgt ggcttggaag tgatgctcca tgtgacgacg actttgcttt ctttcctctt      6480
     agtgaggagg tgattcgtag atcccaactg cctatgtaat gtaaataatg tacatttaat      6540
     ttattgctat ggtagcacat tgtatttgtt aatgtacaaa acaaattcta aaaggttgac      6600
     aaatgtatat tttgttgctt aaatgtgtct ttgcagaaat tgacaataaa taacatattt      6660
     tgtgccaaaa aaaaaaaaaa aa                                               6682
//

If you have problems or comments...

PBIL Back to PBIL home page