(data stored in ACNUC31183 zone)

EMBL: AJ628447

ID   AJ628447; SV 1; linear; mRNA; STD; HUM; 6637 BP.
XX
AC   AJ628447;
XX
DT   01-SEP-2004 (Rel. 81, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Homo sapiens mRNA for Rap1 GTPase activating protein 2a (RAP1GA2 gene)
XX
KW   Rap1 GTPase activating protein 2a; RAP1GA2 gene.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-6637
RA   Schultess J.;
RT   ;
RL   Submitted (23-FEB-2004) to the INSDC.
RL   Schultess J., II, Institute for Biochemistry, Theodor-Stern-Kai 7,
RL   Frankfurt/Main, 60590, GERMANY.
XX
RN   [2]
RX   DOI; 10.1182/blood-2004-09-3605.
RX   PUBMED; 15632203.
RA   Schultess J., Danielewski O., Smolenski A.;
RT   "Rap1GAP2 is a new GTPase-activating protein of Rap1 expressed in human
RT   platelets";
RL   Blood 105(8):3185-3192(2005).
XX
DR   MD5; 2d603a7b37d8a1c09925191a66e97a29.
DR   Ensembl-Gn; ENSG00000132359; homo_sapiens.
DR   Ensembl-Tr; ENST00000254695; homo_sapiens.
DR   Ensembl-Tr; ENST00000366401; homo_sapiens.
DR   Ensembl-Tr; ENST00000540393; homo_sapiens.
DR   Ensembl-Tr; ENST00000542807; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..6637
FT                   /organism="Homo sapiens"
FT                   /chromosome="17"
FT                   /map="17p13.3"
FT                   /mol_type="mRNA"
FT                   /country="Germany"
FT                   /cell_type="platelets"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        91..2238
FT                   /gene="RAP1GA2"
FT                   /product="Rap1 GTPase activating protein 2a"
FT                   /db_xref="GOA:Q684P5"
FT                   /db_xref="H-InvDB:HIT000249325_01.9"
FT                   /db_xref="HGNC:HGNC:29176"
FT                   /db_xref="InterPro:IPR000331"
FT                   /db_xref="InterPro:IPR035974"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q684P5"
FT                   /protein_id="CAF31653.1"
FT                   /translation="MFGRKRSVSFGGFGWIDKTMLASLKVKKQELANSSDATLPDRPLS
FT                   PPLTAPPTMKSSEFFEMLEKMQDDYIPYPSIDEVVEKGGPYPQVILPQFGGYWIEDPEN
FT                   VGTPTSLGSSICEEEEEDNLSPNTFGYKLECKGEARAYRRHFLGKDHLNFYCTGSSLGN
FT                   LILSVKCEEAEGIEYLRVILRSKLKTVHERIPLAGLSKLPSVPQIAKAFCDDAVGLRFN
FT                   PVLYPKASQMIVSYDEHEVNNTFKFGVIYQKARQTLEEELFGNNEESPAFKEFLDLLGD
FT                   TITLQDFNGFRGGLDVTHGQTGVESVYTTFRDREIMFHVSTKLPFTDGDAQQLQRKRHI
FT                   GNDIVAIIFQEENTPFVPDMIASNFLHAYIVVQVETPGTETPSYKVSVTAREDVPTFGP
FT                   PLPSPPVFQKGPEFREFLLTKLTNAENACCKSDKFAKLEDRTRAALLDNLHDELHAHTQ
FT                   AMLGLGPEEDKFENGGHGGFLESFKRAIRVRSHSMETMVGGQKKSHSGGIPGSLSGGIS
FT                   HNSMEVTKTTFSPPVVAATVKNQSRSPIKRRSGLFPRLHTGSEGQGDSRARCDSTSSTP
FT                   KTPDGGHSSQEIKSETSSNPSSPEICPNKEKPFMKLKENGRAISRSSSSTSSVSSTAGE
FT                   GEAMEEGDSGGSQPSTTSPFKQEVFVYSPSPSSESPSLGAAATPIIMSRSPTDAKSRNS
FT                   PRSNLKFRFDKLSHASSGAGH"
FT   regulatory      6600..6605
FT                   /gene="RAP1GA2"
FT                   /regulatory_class="polyA_signal_sequence"
XX
SQ   Sequence 6637 BP; 1424 A; 1859 C; 1848 G; 1506 T; 0 other;
     actgaccccg ctgtaccacg gccctcttgc ggacagcccc ggggacgtcg ttgggacatc        60
     gctgggaccc cgggctctgc agccacaacc atgtttggcc ggaagcgcag tgtctccttt       120
     gggggcttcg gatggatcga caagaccatg ctggcaagtc tgaaggtcaa gaagcaggag       180
     ctggccaaca gctcggatgc gaccctccca gaccggccgc tctcccctcc tctcacggca       240
     cctcccacca tgaagtcgtc ggagttcttt gagatgctgg agaaaatgca ggacgactat       300
     atcccatacc ccagcatcga cgaggttgtg gagaagggag gcccgtaccc tcaggtcatc       360
     ctgccacagt ttgggggcta ttggatcgag gacccggaga acgtgggcac cccaacatcg       420
     ctggggagca gcatctgtga ggaggaggaa gaggacaacc tcagccccaa cacatttggc       480
     tacaagctcg agtgcaaggg tgaagccagg gcctaccgga ggcacttcct ggggaaggat       540
     catctaaact tttactgtac cggcagcagc ctggggaact tgatcctgtc cgtcaagtgc       600
     gaggaagcag aggggatcga gtacctccgg gtcatcctca ggtccaaact gaagacggta       660
     catgagcgga tccccttggc tggactgagc aagcttccca gtgtccctca gattgcaaag       720
     gctttctgtg atgatgcagt gggactgaga ttcaatcctg tcctgtaccc caaggcctcc       780
     caaatgattg tgtcctatga tgagcatgaa gtcaacaaca cattcaaatt cggagtcatt       840
     tatcaaaaag ccaggcagac cctggaggag gagctatttg ggaacaatga ggagagccca       900
     gcttttaagg agttcttgga cctgctgggg gacacgatca cactgcagga tttcaatggt       960
     ttccgaggag gcctggacgt gacccacgga cagacagggg tggaatcagt gtacacaaca      1020
     ttccgggaca gggagatcat gtttcacgtt tccacaaagc tgccatttac cgacggagac      1080
     gcccagcagc tccagagaaa gagacacatt ggaaatgaca tcgtggccat catcttccaa      1140
     gaggaaaaca cgccgtttgt cccagacatg atagcctcca atttcttaca tgcctacatc      1200
     gtcgtgcagg tcgagacccc aggcacagag accccatcct acaaggtctc tgtcactgcg      1260
     cgggaagatg tgcccacctt tggtccacct ctgcccagtc cccccgtttt ccagaagggc      1320
     ccggaattca gggagtttct gctcaccaag ctcaccaatg ccgagaacgc ctgctgcaag      1380
     tcggacaagt ttgcaaagct ggaggaccgg accagggctg ccctcctgga caaccttcac      1440
     gatgagctcc acgcccacac acaggccatg ctgggactgg gcccagagga ggacaagttt      1500
     gagaatggag gccacggggg gttcctggag tcttttaaga gggccatccg cgtacgcagc      1560
     cactccatgg agaccatggt gggcggccag aagaagtcgc acagtggggg catccctggc      1620
     agcctcagcg ggggcatctc ccacaacagc atggaggtca ccaagaccac cttctcgcct      1680
     ccagtggtgg cggcaacggt gaagaaccag tcacggagtc ccatcaagcg acgctcgggg      1740
     ctcttccccc gcctgcacac gggctcagaa ggccagggcg acagccgggc acgatgtgac      1800
     agcacatcca gcacacccaa gaccccagat ggtggacact cctctcagga gataaagtct      1860
     gagacctcat ccaatcccag ctctccagaa atctgcccca acaaggagaa gcccttcatg      1920
     aagttgaagg aaaacggccg cgccatctcc cgctcctcct ccagcaccag cagcgtcagc      1980
     agcactgcag gggagggcga ggccatggag gagggcgaca gtgggggcag ccagccgtcc      2040
     acgacctcac ccttcaagca ggaggtgttt gtctacagcc cgtccccgag cagcgagagc      2100
     cccagcctgg gggcagctgc caccccaatc atcatgagcc ggagtcccac agatgccaaa      2160
     agcagaaact ccccgagatc gaacctgaaa ttccgctttg acaagctcag ccatgccagc      2220
     tctggtgcgg gtcactaatg tgaaagtgga gtccttcgcc tgtccaaggg aatcccctct      2280
     tctgtcctgg aaaaggctcc tgtaccagca gtttgggagt gccgtccacg accctgacag      2340
     tcccagccct gctgccccat ggccacgtgc ccacagatgt gctgttggtc caggtgtccc      2400
     agtctggcca cagccctgcc tccgccctca cctacatgcc ctcccagccc ctcccatctc      2460
     tggacgaggc ctccttcctc aggttcctcc tgctcctgac ctcccagtgt gatgtccggg      2520
     tcctttatca tcctattcat cctggagagg aaaagtgtcg ggcaaagggg gatctggggg      2580
     gagctcagca gtgactgggg agctggtctg cctcagagac agagtagggg gtgggagcag      2640
     agcctcggtg agggtcttgg ccacagggca gtgccttcct gaacgtggca ggctttacta      2700
     ccaggaacgc actcggtggt ggaggcccca tgttcccagg agccaagatt cgtagcatcc      2760
     ttgaggccat cctgataaaa ttcggcgcta ttgcccccgt agctctggag ctctaaaccg      2820
     tctatctgct tctgtgctga acgcctttcc catctgctga cgtaggccca gggctgccct      2880
     gcccctgctg ccagtgtacc gtgagcgggg ctccagccag ttcaagctca gagccagagc      2940
     tggacgggcc agaactgcgc tgcacacttc ctggactgag gcggggactt tgggtcccac      3000
     ccggtttctc ctgattatgg ctgctgtggg gtgaggggag ggaggggcag ccccgaggca      3060
     gtctcttccc tttgagaaga tattttccca caaaggggtg ggaagccagg agtgagaagg      3120
     aattcaggga gagcaaagga gccagtgctg agatgctgct gtgttggttg aggaaaacct      3180
     cgggcctgag ggccaggccg gagcccaggt ctctgctgac aatgggggtt caaggaagac      3240
     gtcgttatct cccctcccca cttactcgag gagagaggtg agggggggat gacttgcggg      3300
     ttctgatcag gcccctgggt ggggaagggg cacagtgtcc ctcagcagct tacgcccctg      3360
     gagtcttggg gggcccagcc tggccctggg gccttttcca gctactgtgc ccttgggtag      3420
     ctgcgtctgg ggctcaaccc cccaatcctg ttcccctctc cagctgcggg tctgtaggca      3480
     gctgtcacat ctgaagggtt tctgcaacct ggaccccatc tgggtgtggg tcagactctg      3540
     tgacccacat gccaccccca ccctccacag agcccccttg ctgggacagc cagctcacct      3600
     ccaaggacat cccctcctgg cttctccccc ttccgagtct gcagcgccgt gggcttctct      3660
     gccgatgggc ccgggttggg gttaaggtgg gcatcctcca ggtacaacga gcctgaagag      3720
     cccctttcag tgcagacggg gctgcagagt gacactggct gggcacctgc cccacgacca      3780
     atgacaagga tttccagctg aatgctttat tcccataggg atctggacct gtgcccaaga      3840
     tataaatact acactttttt tttttttttt tttttaactg acattgtgaa attctcccta      3900
     tagcttttgc cattcaagca acattgtgat ctttcttccc cgccacgtgt gtgggaatga      3960
     ttgagtcctg tttgcaagct ggagaggagc tctcccttcg ctagtacttt ctctaaagta      4020
     ctagtctagt aaaatttatt cttgttagaa ggtcaacaaa atatctgttt agcttttatg      4080
     aagagtcacc gtagcagccc ccacggctgg aaagaggccc gtacgttctg gacgcgtttt      4140
     gttggctggg cttctggagg cactggcaag gtcaaactgc atttctttaa gaacagttgc      4200
     aggatctggc ttgcctctgt gggaagccgg cattacaggt gcttggtgga tgggccgtgt      4260
     cacattgcca tctggggtcc tttggggttt ccaggttgtc agcatgctgt cccatttggg      4320
     aatcccatac ctgcctgtcc ccactgcgct ggctgaccct tgctgcctgc tgcctcttgg      4380
     gagggctttg tcccttgcct ctgagctggt gggcaggatg gctgggtggc ccccagagaa      4440
     gcacagacct gggatggggt ctccatgccc ggtttgctgt tggaatgatc tgaacaggac      4500
     cccaaatgcc tcttccctct ggtcatgcct cactatctct aggagctcca tcctgtggct      4560
     tccagagtgt gcacttccag cccacccggg cagtgctgag agggaggagg agaacaagga      4620
     tggcccagcc tcccctccct cccctagacc acggggcggg cagctcgggt tcctggaggg      4680
     ctgtttcccc cacgctgtcc ctacatctgc tctgatctaa aatgtctttc cttttatgct      4740
     gcgcccagtc ttggggctca aagatttgcc caaacctcat tggccctcgt gactaggctc      4800
     atctagatgg tgctcacgct ggtgtttgag gcatttccac tgtgatctcc acgaggggat      4860
     gttttccggg acacatctct ggctctggga actgcctgac tcactgaaga aactactttt      4920
     caggcactgt agggtcaccc atatgcctcc agctcagttg acgcttaaaa acaggtgcag      4980
     aaaagctcgc gatggaaggt cttaatgaga gtgtctgtct atgccagtca tgtaaaatga      5040
     cgtttcttga aaaagattca gtggttcagc tttgtcagca tcatctcaac acaagcctgc      5100
     tggctctttt tagcatctca tccaaccatg tcatcgtcca gatgagaaat cttagcccag      5160
     gtgaggggaa taacttgctt gaggtcacac agctggctgt tggcaaagct gggattagaa      5220
     ccctcaaccc agggtccctt cctctgcagc gcctacatgg ttggttgaat aagtggctgc      5280
     gtttcctggg gccctgggtt ttggggaagc cagttagctg ctgctttggc actggcatgg      5340
     aggtgagcag tcaaggatgc tggtgaggcc gcagtttctg ctctttttca tcagggggga      5400
     tagtctctag gatttttcag tgaggaccct tgggctttgg atgcagcttg aaccaagaaa      5460
     acgaggaggg aaagggattc agtgaactat tcctcagtgg gatcggttct tcagctcctg      5520
     atgggggctg tgtaatgggg gcagaggcca gggaaaaaga tgctgttcac ccaccctcag      5580
     cttccctttt cctaaattaa gaggaaaagt ggtcaaagaa aaactcttca tttctccctg      5640
     attcttaagc gaaggtggtt aatagaaact caggctcccg tgacaaggca ggacaagagc      5700
     ctgtttcgct ttcctccctg accctgccag gtgccaactc aaacactacc tttctcattg      5760
     gtttctaagt cagtagagac agatctgttt taagcagttg ggggttcgag tagatctcat      5820
     gggtacagga ggccagcagg gaccaggcca gtcagccatg ctcaggaccc ctcggctcct      5880
     cccccagcct ctagctaccc tgtatcgagg caaggggagg ccagtaaagt ttgccaagcc      5940
     tgatcctgca gcctggtggg gctggctggg gtattctttt accaaactct gttttaccgc      6000
     cagccccttg tacaccccaa tcccatgtct ccctcccttc agctggaccg tgtgcccctt      6060
     tgggaggaag aagacaagcg ccactagggc caagggcagc agagccctgc cgagtgagag      6120
     gctgtggggc agcggctctg tcctgtgcct taccagccct ggggaggggg acatttggct      6180
     ggaagactgg aatttaattg ccatcgtctt tgattttgtg acatttctgc ttggaagtgt      6240
     gaactaccct cccccccccg cttcctgctc cttagcatgc gtgcagctct ctcctgtttt      6300
     gggtgttacc cttggacact ccagctcggg gactgctggc gtgtgagtgt gcagattccc      6360
     ctgtgtggtc gaacctaaga actgtggctt ggaagtgatg ctccatgtga cgacgacttt      6420
     gctttctttc ctcttagtga ggaggtgatt cgtagatccc aactgcctat gtaatgtaaa      6480
     taatgtacat ttaatttatt gctatggtag cacattgtat ttgttaatgt acaaaacaaa      6540
     ttctaaaagg ttgacaaatg tatattttgt tgcttaaatg tgtctttgca gaaattgaca      6600
     ataaataaca tattttgtgc caaaaaaaaa aaaaaaa                               6637
//

If you have problems or comments...

PBIL Back to PBIL home page