(data stored in ACNUC18020 zone)

EMBL: AJ719332

ID   AJ719332; SV 1; linear; mRNA; STD; VRT; 1984 BP.
XX
AC   AJ719332;
XX
DT   30-SEP-2004 (Rel. 81, Created)
DT   12-JAN-2005 (Rel. 82, Last updated, Version 2)
XX
DE   Gallus gallus mRNA for hypothetical protein, clone 1h13
XX
KW   ORF1.
XX
OS   Gallus gallus (chicken)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
OC   Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae;
OC   Phasianinae; Gallus.
XX
RN   [1]
RP   1-1984
RA   Caldwell R.B.;
RT   ;
RL   Submitted (20-MAY-2004) to the INSDC.
RL   Caldwell R.B., GSF - Forschungszentrum, Institut fuer Molekulare
RL   Strahlenbiologie, Ingolstaedter Landstr. 1, D-85764 Neuherberg, GERMANY.
XX
RN   [2]
RX   DOI; 10.1186/gb-2004-6-1-r6.
RX   PUBMED; 15642098.
RA   Caldwell R.B., Kierzek A.M., Arakawa H., Bezzubov Y., Zaim J., Fiedler P.,
RA   Kutter S., Blagodatski A., Kostovska D., Koter M., Plachy J., Carninci P.,
RA   Hayashizaki Y., Buerstedde J.M.;
RT   "Full-length cDNAs from chicken bursal lymphocytes to facilitate gene
RT   function analysis";
RL   Genome Biol. 6(1):R6-R6(2005).
XX
DR   MD5; eddaabb6dd24fe87cf8548346fc4be3b.
DR   Ensembl-Gn; ENSGALG00000028749; gallus_gallus.
DR   Ensembl-Tr; ENSGALT00000061419; gallus_gallus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1984
FT                   /organism="Gallus gallus"
FT                   /strain="CB"
FT                   /mol_type="mRNA"
FT                   /dev_stage="2 weeks old"
FT                   /clone_lib="riken1"
FT                   /clone="1h13"
FT                   /cell_type="lymphocyte"
FT                   /tissue_type="bursa"
FT                   /db_xref="taxon:9031"
FT   5'UTR           <1..87
FT                   /locus_tag="RCJMB04_1h13"
FT   CDS_pept        88..1215
FT                   /locus_tag="RCJMB04_1h13"
FT                   /product="hypothetical protein"
FT                   /note="ORF1"
FT                   /db_xref="GOA:Q5ZMQ2"
FT                   /db_xref="InterPro:IPR004000"
FT                   /db_xref="InterPro:IPR004001"
FT                   /db_xref="InterPro:IPR020902"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZMQ2"
FT                   /protein_id="CAG30991.1"
FT                   /translation="MEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMV
FT                   GMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVL
FT                   LTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTV
FT                   PIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALD
FT                   FEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNS
FT                   IMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVW
FT                   IGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF"
FT   3'UTR           1216..>1984
FT                   /locus_tag="RCJMB04_1h13"
XX
SQ   Sequence 1984 BP; 446 A; 576 C; 528 G; 434 T; 0 other;
     ctcactccgc cggcggcagc ggaccgcgtg cagcgtcacc gctctcttca gcaccgggcg        60
     cagcctcccc gcacagagca ccccaggatg gaagaggaga tcgcagcgct cgtgatcgac       120
     aatggctccg gcatgtgcaa ggcgggattc gccggggatg acgctccccg cgccgtgttc       180
     ccgtccatcg tgggccgccc ccggcaccag ggcgtgatgg tgggcatggg gcagaaggac       240
     agctatgtgg gcgatgaggc gcagagcaag aggggcatcc tgaccctgaa gtaccccatc       300
     gagcacggca tcgtcaccaa ctgggacgac atggagaaga tctggcacca caccttctac       360
     aacgagctgc gcgtggcgcc cgaggagcac ccggtgctgc tcacggaggc gccgctcaac       420
     cccaaggcca accgcgagaa gatgacgcag atcatgtttg agacgttcaa cacccctgcc       480
     atgtacgtgg ccatccaggc cgtgctgtcc ctgtacgcct ccggtcgcac cacaggcatc       540
     gttatggact ctggggacgg tgtcacccac acggtgccca tctatgaggg ctacgctctg       600
     ccccacgcca tcctgcgtct ggacctggcc ggccgcgacc tgaccgacta cctcatgaag       660
     atcctgacag agaggggcta cagcttcacc accacggctg agagggaaat cgtgcgtgac       720
     atcaaagaga agctgtgcta cgtcgccctg gacttcgagc aggagatggc cactgctgcc       780
     tcttcctcct ccctggagaa gagctacgag ctgcctgacg ggcaggtcat caccatcggc       840
     aacgagcggt tccggtgtcc ggaggctctg ttccaaccct ctttcctggg catggagtcg       900
     tgcggcatcc acgagaccac tttcaactcc atcatgaagt gtgatgtcga catcaggaag       960
     gatctgtacg ccaacacggt gctgtccggc ggtaccacca tgtaccccgg catcgccgac      1020
     agaatgcaga aggagatcac agccctggca cccagcacga tgaagatcaa gatcatcgcc      1080
     cctccggagc gtaagtactc ggtgtggatc ggcggctcca tcctggcctc cctatccacc      1140
     ttccagcaga tgtggatcag caagcaggag tatgacgagt ccggcccatc catcgtgcac      1200
     cgtaaatgct tctaaatgga ctgctggcag gtgcacagca tctgctgcat gagtcgtctc      1260
     actagtatac gtttgccctg gcaaatctat acacctcatg ctagcctcat aaaactggaa      1320
     taagccttct ttcaaaagaa actttgccct tggaaagtct gtacctgatg ttagatgtgt      1380
     cagcactgga ttgtcgagct ggcccttgat ttgaccttgt attcgagtcc accgttcctt      1440
     cggtgcacac cttttagaga aataccctgc acagatctgc gcgggggggc tgtgctgcgt      1500
     gcccagatgt gtacagggta ttgagagtcg gtcaggcttc catccagtgc ggagtattcc      1560
     agatttggtg tagaggctgg taggagtcca tccacaccca cttctgtcgc cgccgttcta      1620
     agcaaggttg ggaaacatat cgcatccgag ccttaccaac cagccctcct cctcccctct      1680
     gcaaccacca cggggctgag gttcctcaac gcgggttgct gaaacttggc attgacacct      1740
     gtaaatttat gcatcgtttt aatttatgta agactttttt tttctttttt ttcctttttt      1800
     gggttgtttt tttgtttttt tttttgtacg ttgccttaaa tgttctcacg tgatggtagg      1860
     aaaccaaatt gggaaagtca tcctccaggt tgagaaaatt gttaacgccc aacgacacat      1920
     cattgtgtaa ggaaataata ataaaggaaa aaagctgcag taaactccaa aaaaaaaaaa      1980
     aaaa                                                                   1984
//

If you have problems or comments...

PBIL Back to PBIL home page