(data stored in ACNUC18020 zone)

EMBL: AJ719605

ID   AJ719605; SV 1; linear; mRNA; STD; VRT; 728 BP.
XX
AC   AJ719605;
XX
DT   30-SEP-2004 (Rel. 81, Created)
DT   12-JAN-2005 (Rel. 82, Last updated, Version 2)
XX
DE   Gallus gallus mRNA for hypothetical protein, clone 4h19
XX
KW   ORF1.
XX
OS   Gallus gallus (chicken)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
OC   Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae;
OC   Phasianinae; Gallus.
XX
RN   [1]
RP   1-728
RA   Caldwell R.B.;
RT   ;
RL   Submitted (20-MAY-2004) to the INSDC.
RL   Caldwell R.B., GSF - Forschungszentrum, Institut fuer Molekulare
RL   Strahlenbiologie, Ingolstaedter Landstr. 1, D-85764 Neuherberg, GERMANY.
XX
RN   [2]
RX   DOI; 10.1186/gb-2004-6-1-r6.
RX   PUBMED; 15642098.
RA   Caldwell R.B., Kierzek A.M., Arakawa H., Bezzubov Y., Zaim J., Fiedler P.,
RA   Kutter S., Blagodatski A., Kostovska D., Koter M., Plachy J., Carninci P.,
RA   Hayashizaki Y., Buerstedde J.M.;
RT   "Full-length cDNAs from chicken bursal lymphocytes to facilitate gene
RT   function analysis";
RL   Genome Biol. 6(1):R6-R6(2005).
XX
DR   MD5; 318648afda52f6463be0c4e08409d5f9.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..728
FT                   /organism="Gallus gallus"
FT                   /strain="CB"
FT                   /mol_type="mRNA"
FT                   /dev_stage="2 weeks old"
FT                   /clone_lib="riken1"
FT                   /clone="4h19"
FT                   /cell_type="lymphocyte"
FT                   /tissue_type="bursa"
FT                   /db_xref="taxon:9031"
FT   5'UTR           <1..87
FT                   /locus_tag="RCJMB04_4h19"
FT   CDS_pept        88..720
FT                   /locus_tag="RCJMB04_4h19"
FT                   /product="hypothetical protein"
FT                   /note="ORF1"
FT                   /db_xref="GOA:Q5ZLX9"
FT                   /db_xref="InterPro:IPR004000"
FT                   /db_xref="InterPro:IPR004001"
FT                   /db_xref="InterPro:IPR020902"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZLX9"
FT                   /protein_id="CAG31264.1"
FT                   /translation="MEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMV
FT                   GMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVL
FT                   LTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTV
FT                   PIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVA"
FT   3'UTR           721..>728
FT                   /locus_tag="RCJMB04_4h19"
XX
SQ   Sequence 728 BP; 148 A; 246 C; 223 G; 111 T; 0 other;
     ctcactccgc cggcggcagc ggaccgcgtg cagcgtcacc gctctcttca gcaccgggcg        60
     cagcctcccc gcacagagca ccccaggatg gaagaggaga tcgcagcgct cgtgatcgac       120
     aatggctccg gcatgtgcaa ggcgggattc gccggggatg acgctccccg cgccgtgttc       180
     ccgtccatcg tgggccgccc ccggcaccag ggcgtgatgg tgggcatggg gcagaaggac       240
     agctatgtgg gcgatgaggc gcagagcaag aggggcatcc tgaccctgaa gtaccccatc       300
     gagcacggca tcgtcaccaa ctgggacgac atggagaaga tctggcacca caccttctac       360
     aacgagctgc gcgtggcgcc cgaggagcac ccggtgctgc tcacggaggc gccgctcaac       420
     cccaaggcca accgcgagaa gatgacgcag atcatgtttg agaccttcaa cacccctgcc       480
     atgtacgtgg ccatccaggc cgtgctgtcc ctgtacgcct ccggtcgcac cacaggcatc       540
     gttatggact ctggggacgg tgtcacccac acggtgccca tctatgaggg ctacgctctg       600
     ccccacgcca tcctgcgtct ggacctggcc ggccgcgacc tgaccgacta cctcatgaag       660
     atcctgacag agaggggcta cagcttcacc accacggctg agagggaaat cgttgcgtga       720
     catcaaaa                                                                728
//

If you have problems or comments...

PBIL Back to PBIL home page