(data stored in ACNUC18020 zone)

EMBL: AJ719662

ID   AJ719662; SV 1; linear; mRNA; STD; VRT; 2375 BP.
XX
AC   AJ719662;
XX
DT   30-SEP-2004 (Rel. 81, Created)
DT   12-JAN-2005 (Rel. 82, Last updated, Version 2)
XX
DE   Gallus gallus mRNA for hypothetical protein, clone 5b1
XX
KW   ORF1.
XX
OS   Gallus gallus (chicken)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
OC   Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae;
OC   Phasianinae; Gallus.
XX
RN   [1]
RP   1-2375
RA   Caldwell R.B.;
RT   ;
RL   Submitted (20-MAY-2004) to the INSDC.
RL   Caldwell R.B., GSF - Forschungszentrum, Institut fuer Molekulare
RL   Strahlenbiologie, Ingolstaedter Landstr. 1, D-85764 Neuherberg, GERMANY.
XX
RN   [2]
RX   DOI; 10.1186/gb-2004-6-1-r6.
RX   PUBMED; 15642098.
RA   Caldwell R.B., Kierzek A.M., Arakawa H., Bezzubov Y., Zaim J., Fiedler P.,
RA   Kutter S., Blagodatski A., Kostovska D., Koter M., Plachy J., Carninci P.,
RA   Hayashizaki Y., Buerstedde J.M.;
RT   "Full-length cDNAs from chicken bursal lymphocytes to facilitate gene
RT   function analysis";
RL   Genome Biol. 6(1):R6-R6(2005).
XX
DR   MD5; 47436ef4689fd31fd13b0725065046f8.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2375
FT                   /organism="Gallus gallus"
FT                   /strain="CB"
FT                   /mol_type="mRNA"
FT                   /dev_stage="2 weeks old"
FT                   /clone_lib="riken1"
FT                   /clone="5b1"
FT                   /cell_type="lymphocyte"
FT                   /tissue_type="bursa"
FT                   /db_xref="taxon:9031"
FT   5'UTR           <1..89
FT                   /locus_tag="RCJMB04_5b1"
FT   CDS_pept        90..1610
FT                   /locus_tag="RCJMB04_5b1"
FT                   /product="hypothetical protein"
FT                   /note="ORF1"
FT                   /db_xref="GOA:Q5ZLS2"
FT                   /db_xref="InterPro:IPR004443"
FT                   /db_xref="InterPro:IPR019050"
FT                   /db_xref="InterPro:IPR025609"
FT                   /db_xref="InterPro:IPR025762"
FT                   /db_xref="InterPro:IPR034107"
FT                   /db_xref="InterPro:IPR036652"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZLS2"
FT                   /protein_id="CAG31321.1"
FT                   /translation="MATDWLGSIVSINCGESLGVYQGRVSAVDQVSQTISLTRPFHNGV
FT                   KCLVPEVTFRAGDITELKILEIPGPGDSRQCGDLQQADTGIPGVGCQVGPSQNGTGKML
FT                   KKPFSSSAPQNIPRRTDMKNQDIIISPQQQCSKSYMDRHMETLSQSKGFRRRHNSWSSS
FT                   SRHPNQVTPKKSGLKNGQMKSKDDECFGDDIDEIPDTDFDFEGNLALFDKAAVFEEIET
FT                   YERRSGTRSRGTPNEKPARYRHDENILESEPIVYRRIVVPQNANKEFCTDSGLVVPSVS
FT                   YELHKKLLSVAEKHGLTLERRLEMTGVCASQMALSLLGGPNRLNPKNVHQRPTVALLCG
FT                   PHVKGAQGISCGRHLSNHDVHVILFLPNFVKMLESITNELNLFSSTQGQQVSSVKDLPD
FT                   TPVDLVINCLDCHENAFLRDQPWYKAVVDWANQNRAPVLSIDPPISEMEQGIDAKWSLA
FT                   LGLPLPLGERAGRVYLCDIGIPQKVFQEVGINYHSPFGCKFVIPLHST"
FT   3'UTR           1611..>2375
FT                   /locus_tag="RCJMB04_5b1"
XX
SQ   Sequence 2375 BP; 613 A; 568 C; 671 G; 523 T; 0 other;
     ggattccgga cgtcgctgag gcgtgagggg aggcagcggc gggcgggcgg gcgacgagcg        60
     gcggctgtaa gcaattgtgt gccagaaata tggctacgga ctggcttggg agcatcgtgt       120
     caattaattg tggagaaagc ttgggagtct accaagggcg agtgtccgct gtggatcagg       180
     tcagccagac catctccctt acgcggccct tccacaatgg ggtcaagtgc ctcgtgccag       240
     aagtcacttt cagggcaggt gacattactg agctgaaaat tctggagatc ccagggccag       300
     gggacagcag gcagtgtggg gacctgcagc aggcagacac gggcatccct ggggttggct       360
     gccaagtggg gcccagccag aatggcactg gaaagatgtt aaagaagccc ttctccagca       420
     gtgccccgca gaacatcccg aggaggacag acatgaagaa tcaggatatt atcatctccc       480
     cacagcagca gtgctccaag agctatatgg atcgccacat ggaaacactg agtcaatcca       540
     aaggctttcg tcgtaggcat aattcttggt catccagtag ccgccatcca aaccaggtga       600
     ctccaaagaa gagcgggctg aaaaacgggc agatgaagag caaagatgat gagtgcttcg       660
     gggatgacat cgatgaaatc ccagacacag attttgattt tgaggggaac ctggcccttt       720
     ttgacaaggc agccgtgttt gaggagattg agacttacga gaggaggagc ggcacccgtt       780
     cccgtgggac cccaaatgaa aagccagctc gctatcggca cgatgagaac atcttggaat       840
     cagagcccat agtctacaga cggattgtgg taccccagaa tgctaacaaa gaattctgca       900
     cggattccgg gctggttgtg cccagtgtgt catacgagct tcacaaaaaa ctgctgtcag       960
     ttgctgaaaa gcatgggctg accctggaga ggaggctgga gatgacagga gtgtgtgcaa      1020
     gtcagatggc tctgagcctg ctcgggggac ccaacaggct gaaccccaaa aatgtgcatc      1080
     agcggcccac ggtagccctg ctgtgtggcc cccacgtgaa gggggcccag gggatcagct      1140
     gcggacggca cctctccaac cacgacgtcc acgtcatcct tttcctgccc aactttgtca      1200
     agatgctgga gtccattacc aacgagctga acctcttcag cagcacgcaa ggccagcagg      1260
     tgtccagtgt caaagatctc cctgataccc ctgttgacct agtgatcaac tgcctggatt      1320
     gtcacgaaaa tgccttcttg agagatcagc cttggtacaa agcagttgtg gactgggcca      1380
     accagaaccg ggcacccgtc ctcagcatag accctcccat aagcgaaatg gagcagggca      1440
     ttgatgccaa gtggtcgctg gccttgggcc tgcccctacc cctgggtgag agggcagggc      1500
     gtgtgtacct ctgtgacatt ggcattcccc agaaggtctt tcaggaagtg ggaataaact      1560
     accactcacc cttcggctgc aaattcgtca tccccctgca ctccacttag agcccatccg      1620
     gccacgtgga cctgaaggaa aagaagagag aaggagttct gtcaaataag ctgtccagtg      1680
     gaacctgact ggtaaacagg catcacaagc cttaaggatg tgaagttctg gagggtttgc      1740
     ctccagaaga aatattatat taaaaaaaaa aaaacaacgt cataaaatga aacaaaaaga      1800
     aggaagcaaa tgtaactgta aagctgcttt tgttctcttg tgccattgta agaaggaaca      1860
     cgcaggaaag tggtatctgt ccctggcaag tgcagcagtt gctgcccaga gctgccaggg      1920
     gactatttaa catagggatg tgcatggaaa tgttctggta caagcgatgg gtggtgtgga      1980
     gacttgggat gcatttccca gtccttctgg gcaggataga cccagcaagg tgtcctggtg      2040
     ggagcagcac ccctggattg tgtagaatta accttttttt ttttttttcc tgtggttgtg      2100
     gtgggagggt ggatttgatt tttgttctgt tctgttggat tccccctccc tgttctttgg      2160
     tcatgaaggc aatagtagct ccatcccctc gaggagagag ttccctcatc agaaagcttg      2220
     tgtcaggagc cagaagctct cagacagcac atgctctggg agcaccaatg tcctcagata      2280
     ggccttattt gcttatgtat tctcttggct gtttgtttgt ttggggggaa caaagtatgt      2340
     taatgtaaag aacttttcca aaaaaaaaaa aaaaa                                 2375
//

If you have problems or comments...

PBIL Back to PBIL home page