(data stored in ACNUC8465 zone)

EMBL: AJ719928

ID   AJ719928; SV 1; linear; mRNA; STD; VRT; 1481 BP.
XX
AC   AJ719928;
XX
DT   30-SEP-2004 (Rel. 81, Created)
DT   12-JAN-2005 (Rel. 82, Last updated, Version 2)
XX
DE   Gallus gallus mRNA for hypothetical protein, clone 8f10
XX
KW   ORF1.
XX
OS   Gallus gallus (chicken)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
OC   Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae;
OC   Phasianinae; Gallus.
XX
RN   [1]
RP   1-1481
RA   Caldwell R.B.;
RT   ;
RL   Submitted (20-MAY-2004) to the INSDC.
RL   Caldwell R.B., GSF - Forschungszentrum, Institut fuer Molekulare
RL   Strahlenbiologie, Ingolstaedter Landstr. 1, D-85764 Neuherberg, GERMANY.
XX
RN   [2]
RX   DOI; 10.1186/gb-2004-6-1-r6.
RX   PUBMED; 15642098.
RA   Caldwell R.B., Kierzek A.M., Arakawa H., Bezzubov Y., Zaim J., Fiedler P.,
RA   Kutter S., Blagodatski A., Kostovska D., Koter M., Plachy J., Carninci P.,
RA   Hayashizaki Y., Buerstedde J.M.;
RT   "Full-length cDNAs from chicken bursal lymphocytes to facilitate gene
RT   function analysis";
RL   Genome Biol. 6(1):R6-R6(2005).
XX
DR   MD5; b36e9d69da5a2070e56aaabb05af19d5.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1481
FT                   /organism="Gallus gallus"
FT                   /strain="CB"
FT                   /mol_type="mRNA"
FT                   /dev_stage="2 weeks old"
FT                   /clone_lib="riken1"
FT                   /clone="8f10"
FT                   /cell_type="lymphocyte"
FT                   /tissue_type="bursa"
FT                   /db_xref="taxon:9031"
FT   5'UTR           <1..477
FT                   /locus_tag="RCJMB04_8f10"
FT   CDS_pept        478..1254
FT                   /locus_tag="RCJMB04_8f10"
FT                   /product="hypothetical protein"
FT                   /note="ORF1"
FT                   /db_xref="GOA:Q5ZL06"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZL06"
FT                   /protein_id="CAG31587.1"
FT                   /translation="MSVKRIRATVNTQEQKRLLMDLDISMRTVDCFYTVTFYGALFREG
FT                   DVWICMELMDTSLDKFYKKVLEKKKTIPEDILGKMAVSIVRALEHLHSKLSVIHRDVKP
FT                   SNVLINKEGHVKMCDFGISGYLVDSVAKTMDAGCKPYMAPERINPELNQKGYNVKSDVW
FT                   SLGITMIELAILRFPYESWGTPFQQLKQVVEEPSPQLPPERFSKEFVDFTAQCLRKNPA
FT                   ERMNYLELMEHPFFTLHDTKETDMASFVTEILGDDS"
FT   3'UTR           1255..>1481
FT                   /locus_tag="RCJMB04_8f10"
XX
SQ   Sequence 1481 BP; 339 A; 420 C; 413 G; 309 T; 0 other;
     aactgttgga gctttcgagt gtaatcggag cggagccgct gcgctcggct cgcggggtcc        60
     ctgtgctgca ggctgcatcc agccctgctg cgagctaagc gcccggagcc ccctcctgcc       120
     cgccgctctg cccccctcct cgcccccccc gcccccctca gtgctccccg ctgccggctg       180
     tgtgccgttt ctgttcttca tttctgggaa gccacggaca agaagcaaga ttccaaggga       240
     tccctggagc cgcacaaacc agtgaagggc aagaagaagc tgaggataac atgtcctccc       300
     atcaagcagc cccctgtcaa caccacgccg ccaaggaacc tggactccag aaccttcatc       360
     accattggag acaaaaactt cgaggtggaa gctgatgacc tggtgactat ttcagagctg       420
     ggccgggggg cctatggtgt ggtggagaaa gtgaggcatg ctcagagtgg caccatcatg       480
     tccgtgaaga ggattcgtgc cacggtgaac actcaggagc agaagaggct gttgatggac       540
     ctggatatct ccatgaggac ggttgactgc ttctacacgg tcactttcta tggagcccta       600
     ttccgagagg gcgacgtttg gatctgcatg gagctcatgg acacttccct ggataagttc       660
     tacaagaaag tactggagaa gaagaaaacc atcccggaag acatcttagg gaaaatggct       720
     gtgtctattg tacgagctct ggagcatctg cacagtaaac tgtctgtaat ccacagagat       780
     gtgaagcctt ccaacgtgct catcaacaag gagggacatg tgaaaatgtg tgactttggg       840
     atcagtggct acttggtgga ctcggtggcg aagacaatgg atgctggctg caaaccatac       900
     atggctccag aaagaataaa tcctgagctg aaccagaagg gctacaatgt gaagtcggat       960
     gtctggagtc tggggatcac aatgatcgag ttggccatcc tccgcttccc ctatgagtcc      1020
     tggggcaccc cgttccagca gctcaagcag gtggtggagg agccctcacc ccagctgccc      1080
     cccgagcgct tctccaagga gttcgtggac ttcacggcgc agtgtttaag gaagaacccc      1140
     gctgagcgaa tgaactattt agaacttatg gagcacccct tcttcaccct acacgacacc      1200
     aaagagactg acatggcctc cttcgtgaca gagatcctcg gggatgactc ttaactggag      1260
     ccccactgct ccgtgcagtg ccctgaggag cagatgcgga cttcaattcg tggtggtttg      1320
     cacaaattgt gttcctcagc ccccggacag ctctgggcac agccccatcg cagcctcttt      1380
     tctctttgcc tgaaatcttc gaggaagagc cttggaagcc aacaccttca ccccttcaga      1440
     tgctgggggc acgaggaggg gatggtgccc gacctggccc g                          1481
//

If you have problems or comments...

PBIL Back to PBIL home page