(data stored in ACNUC31108 zone)

EMBL: AJ719947

ID   AJ719947; SV 1; linear; mRNA; STD; VRT; 2951 BP.
XX
AC   AJ719947;
XX
DT   30-SEP-2004 (Rel. 81, Created)
DT   12-JAN-2005 (Rel. 82, Last updated, Version 2)
XX
DE   Gallus gallus mRNA for hypothetical protein, clone 8k16
XX
KW   ORF1.
XX
OS   Gallus gallus (chicken)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
OC   Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae;
OC   Phasianinae; Gallus.
XX
RN   [1]
RP   1-2951
RA   Caldwell R.B.;
RT   ;
RL   Submitted (20-MAY-2004) to the INSDC.
RL   Caldwell R.B., GSF - Forschungszentrum, Institut fuer Molekulare
RL   Strahlenbiologie, Ingolstaedter Landstr. 1, D-85764 Neuherberg, GERMANY.
XX
RN   [2]
RX   DOI; 10.1186/gb-2004-6-1-r6.
RX   PUBMED; 15642098.
RA   Caldwell R.B., Kierzek A.M., Arakawa H., Bezzubov Y., Zaim J., Fiedler P.,
RA   Kutter S., Blagodatski A., Kostovska D., Koter M., Plachy J., Carninci P.,
RA   Hayashizaki Y., Buerstedde J.M.;
RT   "Full-length cDNAs from chicken bursal lymphocytes to facilitate gene
RT   function analysis";
RL   Genome Biol. 6(1):R6-R6(2005).
XX
DR   MD5; 7558cb6514449818c04d7e450fc8dbb4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2951
FT                   /organism="Gallus gallus"
FT                   /strain="CB"
FT                   /mol_type="mRNA"
FT                   /dev_stage="2 weeks old"
FT                   /clone_lib="riken1"
FT                   /clone="8k16"
FT                   /cell_type="lymphocyte"
FT                   /tissue_type="bursa"
FT                   /db_xref="taxon:9031"
FT   5'UTR           <1..97
FT                   /locus_tag="RCJMB04_8k16"
FT   CDS_pept        98..895
FT                   /locus_tag="RCJMB04_8k16"
FT                   /product="hypothetical protein"
FT                   /note="ORF1"
FT                   /db_xref="GOA:Q5ZKY7"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="InterPro:IPR018503"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZKY7"
FT                   /protein_id="CAG31606.1"
FT                   /translation="MGSGCLKVTKYFLFLFNLLFLILGAVILGFGIWILADKTSFISVL
FT                   QNSSPSVRTGAYILVGVGSLTMLMGFLGCLGAVNEIRCLLGLYFTCLMMILITQVAAGL
FT                   VIYFQQEELKGELSRIVEKLIGDYDPVNGEDKNLQDAWDYVQKQLTCCGWNGAEEWEKN
FT                   PILINKSMTAYPCSCSNSSKDAEENTGFCTLDVVVNETATHANWPVHRQGCVDGVQDWL
FT                   KDNLGIILGVCTGVAVVELLGMILSISLCKNIHSEDYTKVPKS"
FT   3'UTR           896..>2951
FT                   /locus_tag="RCJMB04_8k16"
XX
SQ   Sequence 2951 BP; 694 A; 672 C; 731 G; 854 T; 0 other;
     gccccgcgct ccgttcgcca gctcaggggt agagcggcgg agggaacgag cggagcgccg        60
     agcgcagcgg gaaggaggat cctgtaagtg agagaagatg gggtctggct gcctgaaagt       120
     caccaagtac ttcctgttcc tcttcaatct cctgttcctt attctgggcg ctgtgatcct       180
     gggttttgga atatggattt tggctgacaa aaccagcttc atttcagttc tgcagaactc       240
     atctccctcc gtgaggactg gcgcatatat ccttgtcggt gttgggtctc tcaccatgct       300
     gatgggattc ctgggctgtc ttggagcagt caatgaaatc agatgtctct tgggtctgta       360
     ctttacctgc ctcatgatga ttctcataac tcaggtggct gcaggactgg tcatctattt       420
     ccagcaagaa gaactgaaag gggagttgtc acgcatagtt gaaaaactga ttggagatta       480
     tgaccctgtg aatggtgaag ataagaactt gcaagatgcg tgggactatg tgcagaaaca       540
     gcttacctgc tgtggctgga atggagcaga ggagtgggag aaaaatccca ttcttatcaa       600
     caaaagcatg actgcgtatc cctgctcctg ctccaatagt tccaaggatg ctgaggaaaa       660
     tacaggcttc tgtacactgg atgtcgtggt gaatgaaact gcaacgcatg ccaactggcc       720
     tgtgcacagg cagggttgtg tggatggggt acaggattgg ttgaaggaca accttggtat       780
     cattcttggg gtctgcacag gcgttgctgt tgtagagctg ctggggatga tactgtccat       840
     ttcactctgc aagaacatac acagtgaaga ctacaccaaa gtgcccaagt cttgagtttg       900
     ttgactccag aactacggca ccacagagaa aggagcaaac agaacattcc tgcctcgtac       960
     ccagactgtc caaccattga ccattactcc tgtgatatcc tatttctgat accactctgc      1020
     tatggactat tagagttgca atacagcctg atttttctgg caatagagcc cttgggctac      1080
     ctacatcctg cctctggatt atttcttctt caagaagcag aacttaactg tcctgcatca      1140
     tgaggcatct tttgccacct gccccacatc ctattcatat ttcagttcta caacctactg      1200
     ggcctaatgt acaataactg ttcctccctg ctatcctcct cccacatctt tcccttggcc      1260
     tccaaaagaa acaccatctt tttgtcccat gagtcagaat tgctgttgag atgccagtgc      1320
     tttggtagct tcacctgctt cactgattgt ggtggtaact agttgtgctt taaaggcctt      1380
     gcaattaacc tgattcctct tctattacgc atcttccagc ctagactctt atctgaacta      1440
     ttgagctcta ccctcatcgt ttctcctgca tctggagtca gtcaagcctt gccttcagtg      1500
     gagctcttcc ctttgagtgt gacaagaagc cactgggagg gagccgggtc aacctgtcac      1560
     tagtgtggtc tggcagattc tggttgtggt gctcacctgc ttttggaatg ggtcacttgg      1620
     gttctggatc tgatggttgc atgtttctct cttccttttt ctccacccct gcgatagttt      1680
     tctggctctt ttcaggcact tcagagactg ctgcatagtg tggactcagc cccaggctgg      1740
     ctgtgttgat tgtgttgggt gccaactttc atacagaggt tgtgattaac tggattcttc      1800
     ccctgccccg ttatgaacat aaaatattaa cagtggtttt tagtaatgag tatggaggga      1860
     tctgacttga ttgcaggcgc tgcatgttgg agatatccct gctaccagtg cccagtttag      1920
     gttttgtagt ttagatgcaa ggataaaact gcttttactt tcggttgttc cagtcctcag      1980
     gctctactgt agtctggagc catgtctgct ggtgactggt cttgagtata agcactgcgg      2040
     cagagaagta gctggttttg cactcgcacg ggctgggtgg tttgtgtact ttagggctgg      2100
     gatgtttgct ccgttcagcc attggccagc agcaaggagt ggtgtagagc acaagaaggc      2160
     aaggaatgtg tgtggaaaaa cctccccgac ttcttagata agggagctgg gtagaaatct      2220
     tcagtcctag aggtagcctg ggcacaacag atttcctgct gctaaatttg cattctagtt      2280
     accctggcag taggaagcaa tctgggagag aagcggatgg tccttgtctg aaccttgata      2340
     caaggtactt ggttgaagga acctttgcct tacagaagcg gtccaaggac cgtcagtcct      2400
     attcttgctg gatggtgttg atagggatag ccctagtagc tagctgttca aaggcatgac      2460
     ttcactacct agtcaacttt tcttctggca agaaaggccc atgcagagga acagggcccc      2520
     agcagtgggt ccctgctgtg tcctcatctc tggactcagc agtgactggg gacagtagat      2580
     atgactggac aactgatctt tatggaggtc tggtaaggct ttgctatttt gagacccctg      2640
     ccctctccta cgcagatcct tcaagctgac ctttgctata gcagaaggca ccttcttagc      2700
     agtaaagctt gctagctttc acagtacaaa gtctattctc taacatgttc ttatttgtaa      2760
     gattcttgtt cggttacaga tgccaatgct gagcagcaag taaaaaggaa cccgtgatgg      2820
     gtttcctctt taattgtttt ttttctgttt ttagcaacat cttcccacgg gaagtaatgc      2880
     atgtacagat ataaaagtct agagagtgaa tatttctgta ataaagactt tgctaaaaaa      2940
     aaaaaaaaaa a                                                           2951
//

If you have problems or comments...

PBIL Back to PBIL home page