(data stored in ACNUC13749 zone)

EMBL: AJ720148

ID   AJ720148; SV 1; linear; mRNA; STD; VRT; 4001 BP.
XX
AC   AJ720148;
XX
DT   30-SEP-2004 (Rel. 81, Created)
DT   12-JAN-2005 (Rel. 82, Last updated, Version 2)
XX
DE   Gallus gallus mRNA for hypothetical protein, clone 11i20
XX
KW   ORF1.
XX
OS   Gallus gallus (chicken)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
OC   Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae;
OC   Phasianinae; Gallus.
XX
RN   [1]
RP   1-4001
RA   Caldwell R.B.;
RT   ;
RL   Submitted (20-MAY-2004) to the INSDC.
RL   Caldwell R.B., GSF - Forschungszentrum, Institut fuer Molekulare
RL   Strahlenbiologie, Ingolstaedter Landstr. 1, D-85764 Neuherberg, GERMANY.
XX
RN   [2]
RX   DOI; 10.1186/gb-2004-6-1-r6.
RX   PUBMED; 15642098.
RA   Caldwell R.B., Kierzek A.M., Arakawa H., Bezzubov Y., Zaim J., Fiedler P.,
RA   Kutter S., Blagodatski A., Kostovska D., Koter M., Plachy J., Carninci P.,
RA   Hayashizaki Y., Buerstedde J.M.;
RT   "Full-length cDNAs from chicken bursal lymphocytes to facilitate gene
RT   function analysis";
RL   Genome Biol. 6(1):R6-R6(2005).
XX
DR   MD5; 2bf30c2608d4c730ad8652d4d84d81fd.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4001
FT                   /organism="Gallus gallus"
FT                   /strain="CB"
FT                   /mol_type="mRNA"
FT                   /dev_stage="2 weeks old"
FT                   /clone_lib="riken1"
FT                   /clone="11i20"
FT                   /cell_type="lymphocyte"
FT                   /tissue_type="bursa"
FT                   /db_xref="taxon:9031"
FT   5'UTR           <1..167
FT                   /locus_tag="RCJMB04_11i20"
FT   CDS_pept        168..539
FT                   /locus_tag="RCJMB04_11i20"
FT                   /product="hypothetical protein"
FT                   /note="ORF1"
FT                   /db_xref="GOA:Q5ZKD6"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR015153"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZKD6"
FT                   /protein_id="CAG31807.1"
FT                   /translation="MIEESGKRRRTMAEKRQLFMEMRAQNFDVIRLSTYRTACKLRFVQ
FT                   KRCNLHLVDIWNMIEAFRDNGLNTLDHNTEINVSRLETIISSIYYQLNKRLPSTHQISV
FT                   EQSISLLLNFMIAAYDSTQ"
FT   3'UTR           540..>4001
FT                   /locus_tag="RCJMB04_11i20"
XX
SQ   Sequence 4001 BP; 991 A; 1031 C; 1094 G; 885 T; 0 other;
     gcgccgtgag gcggccgggg accgttggag cggggacgcc gaggcggagc ggcggcggct        60
     gcggcccggg cggagcgggg aggccatccc ggttgaggtc gtccttcgat gttggcagag       120
     tttgctgagg cgggcgctgc cctgcgaggc tccgtgtgcc atccagaatg attgaggaga       180
     gtgggaagag gaggaggaca atggcggaga agagacagct gttcatggaa atgagggccc       240
     agaactttga tgtcatcaga ctttcaacgt atcgaacagc ctgtaagctg cgctttgtgc       300
     agaaacgatg taaccttcat cttgttgata tctggaatat gattgaagcc ttccgagata       360
     atggccttaa cactttggat cataacacag agatcaacgt gtctcgacta gaaacaatca       420
     tttcatccat ctactaccag ctcaacaaac gccttccttc tactcaccaa atcagcgtag       480
     agcagtccat cagccttctc ctcaacttca tgatagcagc atatgacagc acgcagtaag       540
     gaggagggag aggatgacca acagtcagtg agggccatgg gaagctgaca gtgttttcag       600
     tgaaagcaat gttagcaaca atgtgtggtg gcaaaatact ggacaaacta agatatattt       660
     tctctcaaat atcagattca aacggactaa tgatattctc caagtttgat cagtttttga       720
     aagaagttct aaaacttcca actgctgtgt ttgagggacc ttcttttgga tacacagagc       780
     attctgtacg gacgtgcttc ccacaacaaa aaaagatcac gctaaacatg tttttagaca       840
     cattgatggc tgatccacct cctcagtgcc ttgtgtggct gcctctcatg cacagacttg       900
     cccatgttga aaatgtcttc catcctgtgg agtgttccta ttgccggtgt gagagcatga       960
     tggggttccg atatcggtgc caacagtgcc acaactacca gctctgccaa aactgctttt      1020
     ggcgtggcca tgccagtggg cctcacagca accagcacca gatgaaggag cattcctctt      1080
     ggaaatcgcc tgcgaagaag ctgagccatg caatcagtaa atcacttggc tgtgtaccaa      1140
     gcagagaacc acctcgtccc gtgtttcctg agcagccaga gaagccactt gatcttgcac      1200
     atatagttcc ccctcgacct ctgactaaca tgaatgacgc catggtgacc cacatgtcct      1260
     ctgagcagcc agagaagcca cttgatcttg cacatatagt tccccctcga cctctgacta      1320
     acatgaatga cgccatggtg acccacatgt cctctggagc accaacacca acaaagaggt      1380
     tgcagtgcaa ggcggacgct gctggccgat tggctgatga gcatgcactg attgcaacct      1440
     atgtgagccg gctgcagcgc ggggcacgtg tgctggacag cccaggccgg ctggacgagg      1500
     agcaccgcct gatcgcccgc tacgcagcca ggctggccgc tgaggccagc aacacgcctc      1560
     gcccacccac agacctgggt tttaacttcg atgccaacaa acagcaaaga cagctgatag      1620
     cagagctgga aaacaaaaac agagagatac tgcaggaaat ccagcggctg agactggagc      1680
     acgagcaagc atcacagccc acaccagaga aagcccagca gaacccaacg ctactggctg      1740
     agctccggct cctacggcag agaaaggatg agctggaaca gaggatgtct gcacttcaag      1800
     aaagcagaag agaactgatg gtgcagctcg aagggctgat gaagctactc aaagcacaag      1860
     cagcgggctc ggcgcactcg tcacccaccc acggagccgg ccgcccgctg cccatgcccg      1920
     tcagatccac ctccgccggc tccacaccaa cacacggccc ccaggacatc ggggacatgc      1980
     aagaagcttt cacacaaggt acaaggagga acctgcgcaa cgacctgctg gtggccgccg      2040
     actccatcac caacacaatg tcgtcgctgg tgaaggagct gcactcagca gaggaagaag      2100
     atgaagagga aatggaaaaa atgcagaacg gaaaggatcg aggttagatg ggcaaccaca      2160
     ggctgtacag caattcaggc gcaggggctc tcagtgagct cgtgccccga agacgtcccc      2220
     gcgccgctgg gagaggcacg ttccagctga cccatcacca tcgcgcggct gtgaccgacg      2280
     ttgacctccc accggcgccg gcgttctccc aactgaccga gggctttccc cgtgggcgtt      2340
     tgcctcttag gccattgcat gtactgctat cctcaatgtg tttactaacg ataatcagac      2400
     agtgccccat cgaactctgc catttgcggg aggtccaaga aaaaggcaat actccccgct      2460
     cccgctacgc gttccgatct gttggatttc ccacccaaca gcatcaccat caccatctca      2520
     cgctggctgt ttcctcttgg ctcctgccct ttgctgtgca tgacaaagat gaggtttgct      2580
     ccactgggga ctctttgctt gtaaagcagg ggggactctg agtgcggacc ctttagaccc      2640
     acctagaagc accgctccgc tgtcaggttg ctattgtatt gcatattgca ttgtcctccg      2700
     taagtgatgg cgtgttgggg agaaacgagc agttggaggg ccccggacca gtgcctcttc      2760
     tttaaactgt taccaaatgt ccccttccag gcagggaatt tggggatgag cagctctggg      2820
     ttggcatcag cgtctctgtg ttcattctcg agagccgagt tgggttttgt gtaaaattaa      2880
     gagaaagagt taaattaaga ggaagagttg tgtagtctga ggctgggagc tcaccgccgt      2940
     ctgggtgctt aggaaacatc gcaatcagtt ccaatcacac catttcgggg tttttttttt      3000
     ttccccttgg tgctttggaa tgttattttt agtggaagga gctgagtgcc ctaatgcagc      3060
     cataaatatt tatcaggggt gatgaatggg aaggagcgat aaagcccgaa gccaacggca      3120
     gccaatgcgc cacggagagc gctcgttggg tacctgcagc cctttgggag agcagaaata      3180
     aacagacgtg gtggccacag cctgagccaa gtgtaaatat tgtgagcgag ctgtcaggga      3240
     ggggagagga gtgatgagaa cccgactcag cacgtgcacg gcgcgtgaaa cgcagatcca      3300
     cagggcgccc tcatgactac tctttttttt ttgtattatt gctcactcca tgacttcccc      3360
     ttcttgctct gggggacatg ggtcagtggg cacggtgggg tggggttggg gttggatttg      3420
     gtgacctttg aggtcttttc caactggaat gattctatga ttctgtttag ggatgtggtt      3480
     agcgggtacg gtggcgatgg gttggcagct ggacacagtg atggtggagg tctttcccaa      3540
     ccggaatgat cctgtggctc tgtaggcagc cgtggtggtg ctgggttgac agttggacgt      3600
     gatgactcag cttttacaac ctttctccat gttgggaagc aaaccctaca gcttgcttgt      3660
     gcttaactgg gaacattgca aaccttctgc tggccttcac aatcaccgcc ttaacccctg      3720
     caggaagaac actgcagacc gtgctttccc caagctgaga gctgtgccat catggctcca      3780
     gcacgtgtgc gtctttcctt tcaagtttgg ggttcatttc ttgtgcacac catggggttt      3840
     ggtggctcga tcggtaccgg agcccggagc gcatggtggg gagatgggag tgccattggt      3900
     aggaacctgt gaactggaag ccatgttctg tcatctgcca aacactgaat aaattcatct      3960
     catccctaaa aaaaaaaaaa aaaagaaaaa aaaaaaaaaa a                          4001
//

If you have problems or comments...

PBIL Back to PBIL home page