(data stored in ACNUC13479 zone)

EMBL: AJ720529

ID   AJ720529; SV 1; linear; mRNA; STD; VRT; 2936 BP.
XX
AC   AJ720529;
XX
DT   30-SEP-2004 (Rel. 81, Created)
DT   12-JAN-2005 (Rel. 82, Last updated, Version 2)
XX
DE   Gallus gallus mRNA for hypothetical protein, clone 19k4
XX
KW   ORF1.
XX
OS   Gallus gallus (chicken)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
OC   Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae;
OC   Phasianinae; Gallus.
XX
RN   [1]
RP   1-2936
RA   Caldwell R.B.;
RT   ;
RL   Submitted (20-MAY-2004) to the INSDC.
RL   Caldwell R.B., GSF - Forschungszentrum, Institut fuer Molekulare
RL   Strahlenbiologie, Ingolstaedter Landstr. 1, D-85764 Neuherberg, GERMANY.
XX
RN   [2]
RX   DOI; 10.1186/gb-2004-6-1-r6.
RX   PUBMED; 15642098.
RA   Caldwell R.B., Kierzek A.M., Arakawa H., Bezzubov Y., Zaim J., Fiedler P.,
RA   Kutter S., Blagodatski A., Kostovska D., Koter M., Plachy J., Carninci P.,
RA   Hayashizaki Y., Buerstedde J.M.;
RT   "Full-length cDNAs from chicken bursal lymphocytes to facilitate gene
RT   function analysis";
RL   Genome Biol. 6(1):R6-R6(2005).
XX
DR   MD5; ecbc58881f3cfdba8a36fccb0a673c50.
DR   Ensembl-Gn; ENSGALG00000026302; gallus_gallus.
DR   Ensembl-Tr; ENSGALT00000010418; gallus_gallus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2936
FT                   /organism="Gallus gallus"
FT                   /strain="CB"
FT                   /mol_type="mRNA"
FT                   /dev_stage="2 weeks old"
FT                   /clone_lib="riken1"
FT                   /clone="19k4"
FT                   /cell_type="lymphocyte"
FT                   /tissue_type="bursa"
FT                   /db_xref="taxon:9031"
FT   5'UTR           <1..44
FT                   /locus_tag="RCJMB04_19k4"
FT   CDS_pept        45..821
FT                   /locus_tag="RCJMB04_19k4"
FT                   /product="hypothetical protein"
FT                   /note="ORF1"
FT                   /db_xref="GOA:Q5ZJA5"
FT                   /db_xref="InterPro:IPR019009"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZJA5"
FT                   /protein_id="CAG32188.1"
FT                   /translation="MAGAVEPYLDSLRRELQSPGPASLSVLLALLVVALTFLLWRLAQG
FT                   ARSTRRAVLLLGLCDAGKTLLFARLLTGRYRDTQTSITDSSAVYRVSNDKGTNVTLIDL
FT                   PGHESLRLQFLERFKAAARAIVFVVDSVAFQREVKDVAEFLYQVLVDSTVLKNAPALLI
FT                   ACNKQDVTMAKSAKLIQQQLEKELNTLRVTRSAAPTSLDASATGGPAQLGKKGKDFDFS
FT                   QLPMKVEFVECSARGSKGEEGDADFEDLEKWLAKIA"
FT   3'UTR           822..>2936
FT                   /locus_tag="RCJMB04_19k4"
XX
SQ   Sequence 2936 BP; 640 A; 640 C; 781 G; 875 T; 0 other;
     gtggtgcggc gcggccggaa gcagacgtgt gcgtgcgggc agtgatggcg ggcgccgtgg        60
     agccgtatct ggactcgctc cggcgggagc tgcagtcgcc tggccctgcc tctctctctg       120
     tccttctggc gttgctcgtc gtcgccctca cgttcctgct ctggaggctc gcgcagggcg       180
     caaggagcac ccgcagggcc gtgctgctgc tgggcctctg cgacgcgggg aagacgctgc       240
     tgttcgcccg gctgttgacg ggcagatacc gagatacgca gacctccata accgacagct       300
     ctgccgttta cagagtgagc aacgacaagg gcactaatgt gactttaatc gacctcccag       360
     gccacgaaag cttacggctt cagtttttgg agaggttcaa ggctgcagcc agggccattg       420
     tgtttgtggt ggacagcgta gccttccagc gggaggtgaa ggatgtggct gagttcctgt       480
     accaggtcct ggttgacagc actgttctca aaaatgcacc cgcactgctg atcgcttgca       540
     ataaacaaga tgtcacaatg gcaaaatctg caaaacttat tcaacagcag ctggagaaag       600
     agcttaacac cttacgagtg acccgctctg cagcccccac cagtctggat gcatcagcca       660
     ctgggggccc tgctcagctg gggaagaagg gcaaagactt tgacttctct cagctgccca       720
     tgaaggtgga gtttgtggag tgcagtgctc gtggcagcaa gggagaggag ggagatgctg       780
     actttgagga ccttgagaaa tggctggcca agattgcctg aacagagaag ggcagtgtga       840
     gagggagaga cctgaggagg tggggggaca catctgggga gtgaaagaaa atagatggtt       900
     tgaagtactc ggatcttacc aaaggagaag ctgaaagctg gaaaagcatt gcattgtctt       960
     cctctgcttg ggagcatata acgtttaccg gtgtgatttc ttctgtctct gtcacacgac      1020
     caccttttct tcctctctcc tctacttttt ttcctgtgtt gctgacccaa taggcttctg      1080
     tgtttccctg aaatcttttg cattttcatt gtccagctgc cagtcaactt aggaaggaat      1140
     gcactgccag gtgagtctag aaactgtagc ctgtcctttt ttgctttgct ttggcattgc      1200
     attgctgttt cttcatggag atcacctccc aattctgact tctttttgca gcctctagct      1260
     gcttgggaat gctgccctgg caaagtgcac agattctctc cattggtcag tcgttggggt      1320
     gaatgtaaaa agctgttatc cttttgtctt cttatctcct tattcttcca gactggtgta      1380
     gtcccgtttt tgtggaactt gagggacttg ttaaatttca aaggcaagct ggttggtctg      1440
     tccctgtcac tgtgcagtgc ttgtgtctgg ctgtggtgcc tatatctctg gttgattcct      1500
     tgtgctggac agttcttggg agtttttctt tctgtcaggg ctatgtcttg aaagcttgtt      1560
     ttaccctgtt cctcttcctg tacttaaggc tcttctccaa caggctgtgt aagcacactc      1620
     tgtgaatgac agttacagaa tggtcctagc ttgaaccaat gaaagtggca tatttttgga      1680
     ttcatatgta tgttaggagt tagatctgtt gtgccagaca cttgctgttc tgtctcccat      1740
     ctgcctcctc cccagtgttt acaataaaga gacctttttg tgtttttcat catagcaatt      1800
     gcagcaaaat gaagagagga aggtgagctg atagcacatt agtgtgagca tgattcttcc      1860
     ttatgaggaa gatgctcagt ggagaacatg cgagcttttc ccagtgtttg tttgtggtgg      1920
     ttgaagccaa agctgctgct gtgtctgatc tcatcagtta atcttcaggg aatgcctatt      1980
     gctgtagctc ttggagaggc tcagctggct gctctgaggc ttgttgagac agtagtgggg      2040
     tctgattcag tataccttag acctgaactt tccaaaggac ctttgctttc ctttttcttt      2100
     gctgtagcca ggaacatcgg ttgtgtaaag tgagaacttg cagtagcatc tgcactggtc      2160
     aggtgggaga tgagaccctg tgcttcagtt ttttcctttc agaacaacat ccttaagaca      2220
     cgtggcagtt gccctgccca gcagcgtgat gctctggtgg gatggatgct ggctccacac      2280
     agcatttctg tgaggaggat tattcaccag gattcagtgc tgggaactgc aaggtcctac      2340
     tgcattgaag gtttttccct ctagttttat tgttttctgt ttagttctag gcaaggagca      2400
     agtttatggc tcctagtgga ccttttctgt cctttgtggg tttctgtctg gtttagtgcg      2460
     tgcttaatgg ctcatctgat ctgttatgtt ctttctgtgc atccttggac tccttgtcat      2520
     attgccaaat gttagtagtg atgggaggaa caaaacaggc ttcagccaag acctgtgctc      2580
     acagtggagc tctaaagaaa agctgggagc tgtgctgtcc cacagaggag gggggaagga      2640
     ttatatttag ggagtgtgtt acatttttgg aatttgctgc agccaaagca ttgctgaagt      2700
     gtgtttattg tgcttgaact ccctttgctg gagaatattg ctttttgctt gagtggtagt      2760
     tctgcttgct aagacctacc tccttcaaaa gcagagagtg aacattgccc tctggtggga      2820
     taaagtagca taaggccctg tttggtttta agttattctt tttgaaaaat atttctgtaa      2880
     taaagcattt gaataaatgt ttcttttcaa aaaaaaaaat aaaaaaaaaa aaaaaa          2936
//

If you have problems or comments...

PBIL Back to PBIL home page