(data stored in ACNUC1829 zone)

EMBL: AJ851687

ID   AJ851687; SV 1; linear; mRNA; STD; VRT; 2994 BP.
XX
AC   AJ851687;
XX
DT   21-FEB-2005 (Rel. 82, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Gallus gallus mRNA for hypothetical protein, clone 17m6
XX
KW   ORF1.
XX
OS   Gallus gallus (chicken)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
OC   Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae;
OC   Phasianinae; Gallus.
XX
RN   [1]
RP   1-2994
RA   Caldwell R.B.;
RT   ;
RL   Submitted (12-OCT-2004) to the INSDC.
RL   Caldwell R.B., GSF - Forschungszentrum, Institut fuer Molekulare
RL   Strahlenbiologi, Ingolstaedter Landstr. 1, D-85764 Neuherberg, GERMANY.
XX
RN   [2]
RX   DOI; 10.1186/gb-2004-6-1-r6.
RX   PUBMED; 15642098.
RA   Caldwell R.B., Kierzek A.M., Arakawa H., Bezzubov Y., Zaim J., Fiedler P.,
RA   Kutter S., Blagodatski A., Kostovska D., Koter M., Plachy J., Carninci P.,
RA   Hayashizaki Y., Buerstedde J.M.;
RT   "Full-length cDNAs from chicken bursal lymphocytes to facilitate gene
RT   function analysis";
RL   Genome Biol. 6(1):R6-R6(2005).
XX
DR   MD5; 589a2551b6daca7688b13c0e836d51a6.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2994
FT                   /organism="Gallus gallus"
FT                   /strain="CB"
FT                   /mol_type="mRNA"
FT                   /dev_stage="2 weeks old"
FT                   /clone_lib="riken1"
FT                   /clone="17m6"
FT                   /cell_type="lymphocyte"
FT                   /tissue_type="bursa"
FT                   /db_xref="taxon:9031"
FT   5'UTR           <1..242
FT   CDS_pept        243..743
FT                   /locus_tag="RCJMB04_17m6"
FT                   /product="hypothetical protein"
FT                   /note="ORF1"
FT                   /db_xref="GOA:Q5F3G3"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F3G3"
FT                   /protein_id="CAH65321.1"
FT                   /translation="MMFVGFLGCYGAIQESQCLLGAFFTCLVILFACEVAAGIWGFVNK
FT                   DQIAKDVKQFYDQAFQQALMADSDSSNGKAVVKTFHETLDCCGPDTMVGTLTPLWRDDL
FT                   CSKDLLKGLLKREENCHKKIDELFSGKLYLIGIAAIVVAVIMIFEMILSMVLCCGIRNS
FT                   SVY"
FT   3'UTR           742..>2994
XX
SQ   Sequence 2994 BP; 763 A; 640 C; 709 G; 882 T; 0 other;
     cagaccggga gctgccgccg ccgaagccgc catgggtgga aggctgcacc aagtgcatca        60
     aatatctgct cttcgtcttc aacttcatct tctggctggc cgggggcatc atcctgggag       120
     tagccctgtg gctccgccat gactcgcaga ccaccaacat cctctacctg cagctgggtg       180
     acaagcaggc tcccaacacc ttctatgtcg gaatctacat cctgattgca gttggtgctg       240
     tcatgatgtt cgtgggcttc ctgggatgct acggtgcaat ccaggagtcg cagtgccttc       300
     tgggggcgtt cttcacctgc ctggtgattc tgtttgcctg tgaggttgca gctggaatct       360
     gggggtttgt caacaaagac cagatagcca aagacgtgaa gcagttctac gaccaagcgt       420
     tccaacaggc gctcatggcg gattcggact cgagcaacgg gaaggctgtg gtgaagactt       480
     tccatgaaac gttggactgc tgtggtcctg atactatggt tggaacgctc actcctctgt       540
     ggagagatga cctgtgctcg aaggacttac tgaaaggctt gctgaagcgt gaggaaaact       600
     gccacaaaaa gatcgacgag ctcttctctg ggaagctgta cctgatcggt attgctgcca       660
     tcgtggttgc cgtgatcatg atcttcgaaa tgatcctgag catggtgctg tgctgcggca       720
     taaggaacag ctccgtctac tgaggcgtga gagcggggag gggaaggggg gagcagggct       780
     gacggcgctg gaggggaccc caagtgccac caagtgaccg ggagacattt caacaaaaga       840
     caaagaaaac aatgtatata aatacttcca atattaccat gcagtactta tcatttttat       900
     tttgaagtac tttttttttt tttttttttt ttaataaata aaactttccc gtatccttgt       960
     ggctcagtta gttacacatc agttttgtgt gatagggaaa gctgctgtag cagatctact      1020
     ccttcctccc ccttccccag ccccaaaatt catgaatagc agtggtggag gatgtacaga      1080
     ggagaaggct gcagcctgtt atcagaaatc tttgccttga tttttactct ttcaacacag      1140
     actttttttt ttttaattat tattattttt atatatgcac agtttgatgc tgaagccgga      1200
     tttagctttt ttgggtcatc tgttttcttt tcctaccatc atcctaactc caagcctttc      1260
     cacactgttg tctgggaagc ccaggagaga ggaaggggag tagccccggt tggccgggtg      1320
     cgatgtgtcc cgaggagatg gaggtgaatg ctcctatcgg atccgtttgc atcgctaggt      1380
     aaactcttac catagctcac acagacattt ttttttactc tctgacagtg gaagatcttt      1440
     atggcttttt tttttttttt tttggttgtt tttctatgag ctctgacttt acaaatcggc      1500
     tcatttccag tgatctgtca cgctaaaggg tcagtggctg ggggtgaatt gagtcctggt      1560
     tcttttaata gaacttcctg aaaactaagt tgttctatta tttgttcttt aaacctcact      1620
     gaatgtttat agacataaat ttctggggca aatctagcat tgtacagagc tttccaactg      1680
     atgcttagat acaaacgata ttggggggaa aaaaaagcaa gatttttgta aaaaagaaga      1740
     aaaaaaaagt ccttaacctt aaaaatccta tatttacaca ctgcagggtg acttaagggg      1800
     ttcccagctg tatacgtata cgctttaaaa tgtcatcttt gcatcactct tttgctcagt      1860
     gaagttttcc ctgcttatag catattgccg cactctgtag cattgctggg aaaagttcat      1920
     agcctgattt ttgcaaccac aacaacaaca aaaagaagaa tttaagaaat tgtttctctc      1980
     ttaagacctt tcattttcag ttacagtacc tagagattag cttaccaaaa caagggaatt      2040
     caggcttatt gcaccagtca gacagtttcc tgtgctctgg taagcgctgg ttgccaatta      2100
     gatgcatgtg gcttctgttg tatgccactc gtgtacatag aggggaggag tgacccggga      2160
     tctatgtaat aaaatcagag tgtctctaaa aagatgatct atatgtatag ttctatagat      2220
     atatattttt aagcaaaacc ttttccttag tccaaatggg cacctgagct ggaaatctta      2280
     gcatctctca gctctttgcc acatcgaagc agggaagggg aggatgtaga acttgcagtc      2340
     gacttcctca cttcaggaat gtttctgttt cttcgaggat ttcactctca ccttcacgtt      2400
     gcaggaagga gctccaaatc agatgaggag ggagagttgt tgtcagtatg agcaccttgt      2460
     ccgtggcacg tgggtgccaa aatggaacag gaaattcctg cagtggggca agctgatccc      2520
     tgcagtggct tttctcccct tccgctcacc cccttcccat tcctgccttt tagtatatag      2580
     ggcctttaag aattatatag agggagaaaa atatataaaa ttgcgctagg taagaggagg      2640
     acgtgcttca acagaccttt gttttgaggg ggtttggagg agaaaagatt cagccttaga      2700
     aacagcctta aagcaacact gccctgaatg tccactttgt gcacgtggag aatgaggctc      2760
     gggtttgcag taggtaaccc cttccaggct ccccagcgta gctccttcag gtcatctact      2820
     ctgtggctat agatgtatgc atcggccaag catgcgtgtt tacatttatg tgcatcagga      2880
     ttgtcagcat acagaatgga tgtgtaactc gccgcctttt tcgttgactg ttgataaatg      2940
     tgtataaata tgccattaag catttcagtt ctgttttcaa aaaaaaaaaa aaaa            2994
//

If you have problems or comments...

PBIL Back to PBIL home page