(data stored in SCRATCH zone)

EMBL: AK001757

ID   AK001757; SV 1; linear; mRNA; STD; HUM; 3361 BP.
XX
AC   AK001757;
XX
DT   22-FEB-2000 (Rel. 62, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 8)
XX
DE   Homo sapiens cDNA FLJ10895 fis, clone NT2RP4002905.
XX
KW   fis (full insert sequence); FLI_CDNA; oligo capping.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3361
RA   Isogai T., Otsuki T.;
RT   ;
RL   Submitted (16-FEB-2000) to the INSDC.
RL   Contact:Takao Isogai Helix Research Institute, Genomics Laboratory; 1532-3
RL   Yana, Kisarazu, Chiba 292-0812, Japan E-mail :flj-cdna@nifty.com
XX
RN   [2]
RX   DOI; 10.1038/ng1285.
RX   PUBMED; 14702039.
RA   Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
RA   Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
RA   Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
RA   Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
RA   Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H.,
RA   Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M.,
RA   Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K.,
RA   Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T.,
RA   Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M.,
RA   Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S.,
RA   Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H.,
RA   Tanase T., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M.,
RA   Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
RA   Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S.,
RA   Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S.,
RA   Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H.,
RA   Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M.,
RA   Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M.,
RA   Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y.,
RA   Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N.,
RA   Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S.,
RA   Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T.,
RA   Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M.,
RA   Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y.,
RA   Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y.,
RA   Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T.,
RA   Sugano S.;
RT   "Complete sequencing and characterization of 21,243 full-length human
RT   cDNAs";
RL   Nat Genet 36(1):40-45(2004).
XX
RN   [3]
RA   Isogai T., Ota T., Hayashi K., Sugiyama T., Otsuki T., Suzuki Y.,
RA   Nishikawa T., Nagai K., Sugano S., Ishibashi T., Fujimori K., Tanai H.,
RA   Kimata M., Watanabe M., Hiraoka S., Ishii S., Kawai Y., Saito K.,
RA   Yamamoto J., Wakamatsu A., Nakamura Y., Nagahari K., Masuho Y.,
RA   Kanehori K.;
RT   "NEDO human cDNA sequencing project";
RL   Unpublished.
XX
DR   MD5; 332a9dce106d0beb6761dd0ca73ec2f9.
DR   Ensembl-Gn; ENSG00000107443; homo_sapiens.
DR   Ensembl-Tr; ENST00000265992; homo_sapiens.
DR   Ensembl-Tr; ENST00000403870; homo_sapiens.
DR   Ensembl-Tr; ENST00000465148; homo_sapiens.
XX
CC   NEDO human cDNA sequencing project supported by Ministry of
CC   International Trade and Industry of Japan; cDNA full insert
CC   sequencing: Research Association for Biotechnology; cDNA library
CC   construction, 5'- & 3'-end one pass sequencing and clone
CC   selection: Helix Research Institute (supported by Japan Key
CC   Technology Center etc.) and Department of Virology, Institute of
CC   Medical Science, University of Tokyo.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3361
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NT2RP4"
FT                   /clone="NT2RP4002905"
FT                   /cell_line="NT2"
FT                   /cell_type="teratocarcinoma"
FT                   /note="cloning vector: pME18SFL3"
FT                   /note="mRNA from NT2 neuronal precursor cells after 2-weeks
FT                   retinoic acid (RA) induction."
FT                   /db_xref="taxon:9606"
FT   CDS_pept        10..738
FT                   /codon_start=1
FT                   /db_xref="GOA:Q5T5M9"
FT                   /db_xref="H-InvDB:HIT000004231.17"
FT                   /db_xref="HGNC:HGNC:23434"
FT                   /db_xref="InterPro:IPR004367"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR028859"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="InterPro:IPR039361"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5T5M9"
FT                   /protein_id="BAA91887.1"
FT                   /translation="MELLLLETFQWNLCLPTAAHFIEYYLSEAVHETDLHDGWPMICLE
FT                   KTKLYMAKYADYFLEVSLQAAACVASSRIILRLSPTWPTRLHRLTAYSWDFLVQCIERL
FT                   LIAHDNDVKEANKQRGQAGPQSAQLSVFQTASQPSRPVHFQQPQYLHQTHQTSLQYRHP
FT                   TSEQPSCQQIVSTTHTSSYTLQTCPAGFQTSVQGLGHMQTGVGMSLAIPVEVKPCLSVS
FT                   YNRSYQINEHYPCITPCFER"
XX
SQ   Sequence 3361 BP; 1046 A; 582 C; 667 G; 1066 T; 0 other;
     ttgctacata tggaactatt attattagaa acctttcagt ggaacctctg ccttccaaca        60
     gccgcccatt tcattgagta ttatctctct gaagcagtac acgaaacaga tcttcatgac       120
     ggctggccaa tgatttgctt ggaaaagact aaactctaca tggccaaata tgcagattac       180
     ttcctggaag tatctttgca agctgctgca tgtgtggctt cttcgaggat tatacttcgt       240
     ctttctccaa cgtggcctac aagactacat cgtcttactg cctactcttg ggatttctta       300
     gtgcagtgta ttgaacgact gttgatcgct catgataatg atgtgaaaga agcaaacaaa       360
     cagagagggc aagcaggacc tcagtcagcg caactaagtg tattccagac agcctcccag       420
     ccatcacggc cagttcactt tcagcaacct cagtatctcc atcagacaca tcagacctca       480
     ctgcagtatc gccatcctac gtcagaacaa ccaagctgtc agcagattgt atcgaccaca       540
     cacacctcat cttacacact acagacatgt cctgctggct tccaaactag tgttcagggc       600
     cttgggcaca tgcagactgg tgttgggatg tcactggcaa taccagtaga agttaagccc       660
     tgtctgagtg tttcttacaa ccggagttat cagataaatg aacattaccc ttgtattact       720
     ccatgttttg aaaggtgatt atttgtgaag ctgataaccg acccagactg ctttgtgaca       780
     tgaagctatg ggtaagcgtt ttgtaaactt ctgttcaaaa ggaaagggat ctaaatgaca       840
     tcagaactct tcaggtacca gcaccaggaa gactgaatat cctttttaat gcaccatgaa       900
     tcctgggaga ctaagcaaat taacagtatg tcaaattctg ttacaacaaa tccctgtatg       960
     acaaaaatgt tcaagtcctg gctgatggtc caaatttttc aaaaatattc agtacaacag      1020
     aaaatttgga cagacttcaa tttgccattt tgagatttga cctgtggtag catctgggcc      1080
     taatgttggc ttctaagtca aagactaaat gtttatctca tctatggact tgccaaacag      1140
     tcttttatga aggaaagtta cagtattaat ttttgaaaag gtttttttta ttctgcaatt      1200
     ttttattttt gttctacaca tgaatttttg actaagttta aactcatgaa ttgttatgct      1260
     ataccaatct gcagtaaaaa aaattttttt agatgattct atataacttc gtctcacaaa      1320
     tagtgtaggt atctgggttt atatactaaa attaagggtg gagaagatct tattttttaa      1380
     atcatggtca taatttttct ttttttccct aagtgatcaa catcaaattt ttagaattaa      1440
     aatacattta actcagggaa tttgtactac ttggaaacac ttaactgtaa tgcaacatgc      1500
     cttgggaatg ttatagtgtg aactaccttt ataacatagg ttaaaatacg cttgctaggg      1560
     tgtgttttca aatgagaaca taatatagct cagaatgaag tggtagttcc tgtgattcat      1620
     aatacatatg taggttttgc atatctcagt gcaatccatg atttatactc agaatcgaca      1680
     ttcttaaaaa gttatttcaa gggatggcat aactgtaaga ggtcagtgct agaataaagt      1740
     cctgtaggtt tattttggaa gggactgtgg ccagggtagt tctcaggttg tgctagagca      1800
     gcactttgtt atgtggaaga caggtttttt aagcaacctt tgaatccagc tctagtcagt      1860
     ctaagcaggc aaaggtaact gatgactaaa tttcagtagc tactttcatt ggattgaccc      1920
     tacaactgcc ctgggacatt tcactgtacc agtattaact gcaaacagca ataattgtca      1980
     ttacagcaag ggcagtttgg gggtaaagca ttttggagga ataaccttaa aaagttaaaa      2040
     agtcattgta ataactgata aactgtatac attgtgctcc tttctggggg aagaaagatt      2100
     tggtggaggg aagctttctg gtttaaaaat tagtaaggtg tgtctttttg ttttttttaa      2160
     gatagcactt gaatagaagg gaaaactgca tggcagatac gtgactgcca caatatgcat      2220
     cgaagacaaa cttactataa agatgttgtg ggtatgcagc aggagtctca gtaatcaagc      2280
     caatggcctt tgtcaggaag ggaaggggct caacacagtg atggactgat ccagatggct      2340
     cccggggatg aatgtgggtg ggtagcttct gtcagtatca atgcttagag aaatatcctt      2400
     tccttaaaaa gaaaataact tttatattta gagtacatag ggcatgatgt ggatttatta      2460
     gtctggtaga taaaatgaaa aaccactcag gtaagaacac tcactcatgg cagtttttaa      2520
     gcatgaaaat tgttttctga aagtatcatc acttttcctt tttaaagaag gctgctaatt      2580
     ggattttggt agttcttacc tcaagaaaac ttgaattatt tgggggaaag taggctcaaa      2640
     agagaatata tctttcacat tcacattcag aacccagcaa cctggagtcc aattttcagt      2700
     attttaacta cctcaataat gctatgaatg taagatattg ggatagagat cccaacttga      2760
     aacaacagcc agtgcctgtg gtaacttaat gtcttgtcaa atacttttat tgattggttt      2820
     atatgccatt cttgttatag aagaatatgc cttttaaaaa agcttattaa taacactttc      2880
     ccaatttata ttttaaaaag ctaaagaaca ctggattaat aatcttttgg gagggtagaa      2940
     taaaataatt gattactatt gctgcatacc cggggtggga tggggtggtt ggagaaccag      3000
     aactattttt aaaacattag gtttcaatat aaatacaact cacaactgct agctttgggg      3060
     ggtgggggaa cattgtttgg gttttgtttt gtttaattta ttgattagtc tttaaagtag      3120
     gctttttttt ttttttttga gaatactgga ccatcattaa atgtgtactg tgaagagatt      3180
     aatatgtatg aagggcttta ccaaagtcca ctaaataaac actactcaag tacagactgc      3240
     aaaccaaaat gtatctgtgt tacgacatta attgcaaata gcaagtatgg tgctaaagtc      3300
     tacaccaatg gaattagatg agtgctatgc acttaatttt aaaataaaac tagttttcag      3360
     t                                                                      3361
//

If you have problems or comments...

PBIL Back to PBIL home page