(data stored in SCRATCH zone)

EMBL: AK002583

ID   AK002583; SV 1; linear; mRNA; HTC; MUS; 1573 BP.
XX
AC   AK002583;
XX
DT   08-FEB-2001 (Rel. 66, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 20)
XX
DE   Mus musculus adult male kidney cDNA, RIKEN full-length enriched library,
DE   clone:0610012C09 product:hypothetical protein, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1573
RA   Adachi J., Aizawa K., Akahira S., Akimura T., Arai A., Aono H., Arakawa T.,
RA   Bono H., Carninci P., Fukuda S., Fukunishi Y., Furuno M., Hanagaki T.,
RA   Hara A., Hayatsu N., Hiramoto K., Hiraoka T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Izawa M., Kasukawa T., Kato H., Kawai J., Kojima Y.,
RA   Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T., Miyazaki A.,
RA   Nishi K., Nomura K., Numazaki R., Ohno M., Okazaki Y., Okido T., Owa C.,
RA   Saito H., Saito R., Sakai C., Sakai K., Sano H., Sasaki D., Shibata K.,
RA   Shibata Y., Shinagawa A., Shiraki T., Sogabe Y., Suzuki H., Tagami M.,
RA   Tagawa A., Takahashi F., Tanaka T., Tejima Y., Toya T., Yamamura T.,
RA   Yasunishi A., Yoshida K., Yoshino M., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (10-JUL-2000) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; d947062d2635f4262a9e4f9745eba2fa.
DR   Ensembl-Gn; ENSMUSG00000025353; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017885; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0017860; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0017823; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017824; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017647; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018279; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017208; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0017617; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0017723; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0017718; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0017797; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017746; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018319; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016993; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017267; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000026409; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000217685; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000219215; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000219524; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0027547; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0027519; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0027483; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027496; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0027305; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0028003; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0026901; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0027234; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0027356; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0027342; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0027470; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0027332; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0028027; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0026606; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0026823; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=0610012C09
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1573
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="0610012C09"
FT                   /tissue_type="kidney"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        134..595
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="hypothetical protein (evidence:
FT                   rsCDS,ProCrest,decoder,NCBI CDS Predictor,Longest-ORF)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q9CQZ0"
FT                   /db_xref="InterPro:IPR007203"
FT                   /db_xref="InterPro:IPR029886"
FT                   /db_xref="MGI:MGI:1914094"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CQZ0"
FT                   /protein_id="BAB22207.1"
FT                   /translation="MNVGVAHSEVNPNTRVMNSRGIWLAYIILVGLLHVVLLSIPFFSI
FT                   PVVWTLTNVIHNLAMYIFLHTVKGTPFETPDQGKARLLTHWEQMDYGLQFTSSRKFLSI
FT                   SPIVLYLLASFYTKYDAAHFLINTASLLSVLLPKLPQFHGVRLFGINKY"
FT   regulatory      1554..1559
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      1573
FT                   /note="putative"
XX
SQ   Sequence 1573 BP; 464 A; 360 C; 340 G; 409 T; 0 other;
     ggtgtaagag ccagcgctgt gccccaagcc ggacgggctc ctgaagctgg caggagacag        60
     ctggggaaca agctcaatca gggctaatga ggagactgag ttggactcct gcctgatccc       120
     tcactgtggt aggatgaatg tgggggtggc acacagcgaa gtaaacccca acactcgagt       180
     gatgaacagt cggggcatct ggctggccta catcatcttg gtaggactgc tgcatgtggt       240
     tctcctcagc atccctttct tcagcattcc tgttgtctgg accctgacca acgtcatcca       300
     taacttggca atgtatatct tcctacatac agtcaaaggg acgccctttg agacccctga       360
     ccaaggaaag gctcggcttt tgacacattg ggagcagatg gactatggac tacagtttac       420
     ctcctcgcga aagttcctca gcatctctcc tattgtactt tacctcctgg ccagcttcta       480
     caccaagtac gatgctgctc acttcctcat caacactgcc tcgctgctca gcgtgctgct       540
     gcctaagcta ccccagttcc atggggttcg tctctttgga atcaacaaat actaaaagat       600
     ggtttgctag ttctgcaggc attgagggaa ggcactggaa ctaatatata atgttttccc       660
     ttctccacac tatcttctgt atcttggaag cctgagagat aagataaacc tatctaaact       720
     ccaagaagga agaaactgga aaatggggtt cctgggtcca gtcttcatag ggtcaagatt       780
     ctctgaatca ggaaaggtgg atgaggttaa gggcactacc actcactctc ctctatctag       840
     caagaagcca tcattgttta tgcagctatt ctggtgatta tgtgtttcca tatcttctaa       900
     acctaccaac ttcaagttct gtttggctgt atatttttct taaaataaag tctttcagtt       960
     atggctgaaa tttgataagc aaggacagag agattttctc ataatgctgg ggagaaaatg      1020
     caaaatgctg acttactata aaaaaaactt ttaagcaaaa ttttgtctct actcctttgg      1080
     tccaatacct ttcactcaca gctaacagca aggaaagaat tctcaaataa gaaaaaagag      1140
     ctcacaagtg agtagtggag gcacatgcct ataatactag ctagccctca ggaagtggag      1200
     gcagaggcag gagaatcact gcaatctgga gtccagcctg gtctacacag taagactctt      1260
     atctccaaaa gaaaatagaa aaggactccc agctacatgg gtaaagaaga gaaggaagat      1320
     gtaagttgcc agttatatat ttatagaaag ataatctcct ggctttaaat agatatgtac      1380
     atacaaatat gaacaaactt aaaaaaatac aaacccttgg ctaacaaggg ggcctctggg      1440
     aacccctcta tccttccccc tcacccaagg gcacagggca taaatctgct ttttaaaaat      1500
     taattaattt tggccatcct tgcaacaaca agcctgaagt taggtgtctt accaataaag      1560
     tgaaagtcag agg                                                         1573
//

If you have problems or comments...

PBIL Back to PBIL home page