(data stored in ACNUC1829 zone)

EMBL: AK002709

ID   AK002709; SV 1; linear; mRNA; HTC; MUS; 1219 BP.
XX
AC   AK002709;
XX
DT   08-FEB-2001 (Rel. 66, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 20)
XX
DE   Mus musculus adult male kidney cDNA, RIKEN full-length enriched library,
DE   clone:0610030M18 product:transmembrane 4 superfamily member 7, full insert
DE   sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1219
RA   Adachi J., Aizawa K., Akahira S., Akimura T., Arai A., Aono H., Arakawa T.,
RA   Bono H., Carninci P., Fukuda S., Fukunishi Y., Furuno M., Hanagaki T.,
RA   Hara A., Hayatsu N., Hiramoto K., Hiraoka T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Izawa M., Kasukawa T., Kato H., Kawai J., Kojima Y.,
RA   Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T., Miyazaki A.,
RA   Nishi K., Nomura K., Numazaki R., Ohno M., Okazaki Y., Okido T., Owa C.,
RA   Saito H., Saito R., Sakai C., Sakai K., Sano H., Sasaki D., Shibata K.,
RA   Shibata Y., Shinagawa A., Shiraki T., Sogabe Y., Suzuki H., Tagami M.,
RA   Tagawa A., Takahashi F., Tanaka T., Tejima Y., Toya T., Yamamura T.,
RA   Yasunishi A., Yoshida K., Yoshino M., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (10-JUL-2000) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 712fc74d6e475d47f169ec94d8b56b16.
DR   Ensembl-Gn; ENSMUSG00000025511; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0033236; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0033217; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0033150; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0033218; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0032933; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0033730; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0032263; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0032905; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0033057; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0033010; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0033152; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033043; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0033749; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031967; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0032373; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000026585; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000117634; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0087640; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0087726; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0087662; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0087681; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0087245; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0088186; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0087773; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0087187; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0087382; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0087226; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0087414; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0087265; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0088483; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0087172; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0086282; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=0610030M18
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1219
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="0610030M18"
FT                   /tissue_type="kidney"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        40..756
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="putative"
FT                   /note="transmembrane 4 superfamily member 7
FT                   (MGD|MGI:1928097 GB|NM_053082, evidence: BLASTN, 100%,
FT                   match=1219)"
FT                   /db_xref="GOA:Q9DCK3"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="InterPro:IPR018503"
FT                   /db_xref="MGI:MGI:1928097"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9DCK3"
FT                   /protein_id="BAB22301.1"
FT                   /translation="MARGCLQGVKYLMFAFNLLFWLGGCGVLGVGIWLAATQGNFATLS
FT                   SSFPSLSAANLLIVTGTFVMAIGFVGCIGALKENKCLLLTFFVLLLLVFLLEATIAVLF
FT                   FAYSDKIDSYAQQDLKKGLHLYGTQGNVGLTNAWSIIQTDFRCCGVSNYTDWFEVYNAT
FT                   RVPDSCCLEFSDSCGLHEPGTWWKSPCYETVKAWLQENLLAVGIFGLCTALVQILGLTF
FT                   AMTMYCQVVKADTYCA"
XX
SQ   Sequence 1219 BP; 241 A; 338 C; 343 G; 297 T; 0 other;
     ggccgtgcgg cggcgcgcac agagctgaag cgctgcagca tggcgcgcgg ctgcctccag        60
     ggcgtcaagt acctcatgtt cgccttcaac ctgctcttct ggctgggtgg ctgtggtgtc       120
     ctgggtgttg gcatctggtt ggctgccaca cagggaaact ttgccacctt atcatcctca       180
     tttccatcct tgtcggctgc caacctgctc atcgtcaccg ggaccttcgt catggccatc       240
     ggcttcgtgg gctgcattgg ggccctcaag gagaacaagt gcctactgct cactttcttt       300
     gtgctgctgc tgctagtgtt cctgctggaa gccaccattg ctgtgctctt ctttgcctac       360
     agtgacaaga ttgacagtta tgcccaacaa gacctgaaga agggcctgca tctgtatggc       420
     acacagggca acgtgggcct caccaatgcc tggagcatca tccagactga tttccgatgc       480
     tgtggagttt ccaattacac tgattggttt gaggtataca atgccactcg tgtgcctgac       540
     tcctgctgtc tggagttcag tgatagctgt gggttacatg aacctggtac ctggtggaag       600
     tcgccctgtt atgagacagt gaaggcctgg ctccaggaga acctgctagc tgtgggcatc       660
     tttggactgt gcacggcact ggtgcagatt ctgggcctca ccttcgctat gaccatgtac       720
     tgccaggtgg taaaggcgga cacctactgt gcataggtct cacagcctct gcttctctgc       780
     caaaggaccc gcccacggga aggaagatgt ccaaacccgc tccccctgca ggactggtgt       840
     tctgctgaat gcagggggaa gagctggagg ccagagcacc cagcatccat ccctgcacct       900
     gagggcactc tgcttgggtg gcagcagaca ccagactata gagttgtgcc aaatggcacc       960
     cagggctaag ggcccaggga actttgacac tttttatatc catatatacc ttccagtgtt      1020
     cacacaggat ggggttccca gccttgcatg gttgctaggt tgggggcagg cccagtctgc      1080
     tcaaggccca cgatgatctt ggtgctccag gcagggccag gtcccatgat ccacattcca      1140
     tgacagtgtc gtggttccag atgcatctta ataaagtttg tgagcagact gtgggtcttg      1200
     ccaacaccac aaaggttgt                                                   1219
//

If you have problems or comments...

PBIL Back to PBIL home page