(data stored in ACNUC9306 zone)

EMBL: AK002766

ID   AK002766; SV 1; linear; mRNA; HTC; MUS; 2707 BP.
XX
AC   AK002766;
XX
DT   08-FEB-2001 (Rel. 66, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 21)
XX
DE   Mus musculus adult male kidney cDNA, RIKEN full-length enriched library,
DE   clone:0610037B22 product:villin 2, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2707
RA   Adachi J., Aizawa K., Akahira S., Akimura T., Arai A., Aono H., Arakawa T.,
RA   Bono H., Carninci P., Fukuda S., Fukunishi Y., Furuno M., Hanagaki T.,
RA   Hara A., Hayatsu N., Hiramoto K., Hiraoka T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Izawa M., Kasukawa T., Kato H., Kawai J., Kojima Y.,
RA   Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T., Miyazaki A.,
RA   Nishi K., Nomura K., Numazaki R., Ohno M., Okazaki Y., Okido T., Owa C.,
RA   Saito H., Saito R., Sakai C., Sakai K., Sano H., Sasaki D., Shibata K.,
RA   Shibata Y., Shinagawa A., Shiraki T., Sogabe Y., Suzuki H., Tagami M.,
RA   Tagawa A., Takahashi F., Tanaka T., Tejima Y., Toya T., Yamamura T.,
RA   Yasunishi A., Yoshida K., Yoshino M., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (10-JUL-2000) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; cd18079400440d8fa8cb41054772a8cd.
DR   Ensembl-Gn; ENSMUSG00000052397; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0023117; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0023085; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0023052; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0023088; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0022849; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0023532; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0022364; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0022815; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0022952; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0022926; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0023020; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022944; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0023555; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0022111; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0022418; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000064234; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0045456; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0045435; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0045399; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0045407; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0045153; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0045889; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0045269; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0045056; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0045207; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0045172; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0045285; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0045148; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0045954; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0044852; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0044534; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=0610037B22
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2707
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="0610037B22"
FT                   /tissue_type="kidney"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        112..1872
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="putative"
FT                   /note="villin 2 (MGD|MGI:98931 GB|NM_009510, evidence:
FT                   BLASTN, 99%, match=2688)"
FT                   /db_xref="GOA:P26040"
FT                   /db_xref="InterPro:IPR000299"
FT                   /db_xref="InterPro:IPR000798"
FT                   /db_xref="InterPro:IPR008954"
FT                   /db_xref="InterPro:IPR011174"
FT                   /db_xref="InterPro:IPR011259"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR014352"
FT                   /db_xref="InterPro:IPR018979"
FT                   /db_xref="InterPro:IPR018980"
FT                   /db_xref="InterPro:IPR019747"
FT                   /db_xref="InterPro:IPR019748"
FT                   /db_xref="InterPro:IPR019749"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR035963"
FT                   /db_xref="InterPro:IPR041789"
FT                   /db_xref="MGI:MGI:98931"
FT                   /db_xref="UniProtKB/Swiss-Prot:P26040"
FT                   /protein_id="BAB22341.1"
FT                   /translation="MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYF
FT                   GLQYVDNKGFPTWLKLDKKVSAQEVRKENPVQFKFRAKFYPEDVAEELIQDITQKLFFL
FT                   QVKDGILSDEIYCPPETAVLLGSYAVQAKFGDYNKEMHKSGYLSSERLIPQRVMDQHKL
FT                   SRDQWEDRIQVWHAEHRGMLKDSAMLEYLKIAQDLEMYGINYFEIKNKKGTDLWLGVDA
FT                   LGLNIYEKDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRIL
FT                   QLCMGNHELYMRRRKPDTIEVQQMKAQAREEKHQKQLERQQLETEKKRRETVEREKEQM
FT                   LREKEELMLRLQDYEQKTKRAEKELSEQIEKALQLEEERRRAQEEAERLEADRMAALRA
FT                   KEELERQAQDQIKSQEQLAAELAEYTAKIALLEEARRRKEDEVEEWQHRAKEAQDDLVK
FT                   TKEELHLVMTAPPPPPPPVYEPVNYHVQEGLQDEGAEPMGYSAELSSEGILDDRNEEKR
FT                   ITEAEKNERVQRQLLTLSNELSQARDENKRTHNDIIHNENMRQGRDKYKTLRRIRQGNT
FT                   KQRIDEFEAM"
XX
SQ   Sequence 2707 BP; 738 A; 676 C; 762 G; 531 T; 0 other;
     gggcttccct ccgcctgcag gtcccgacgc gtctccgccg tcgccgtcgc cgtcgcctcc        60
     gccgtacagc cgaatagccg aggacccacg cagagccacc aaccagccaa gatgcccaag       120
     ccaatcaacg tccgggtgac caccatggat gccgagctgg agtttgccat ccagccaaac       180
     accaccggga agcagctctt tgatcaggtg gtaaagacga ttggcctccg ggaagtgtgg       240
     tacttcggcc tccagtatgt agacaataaa ggatttccta cctggctgaa acttgataaa       300
     aaggtctccg cacaggaggt ccgaaaggag aaccctgtcc agtttaaatt ccgggccaag       360
     ttctaccccg aagacgtggc cgaggaactc atccaggaca tcacacagaa gctcttcttc       420
     ctgcaagtca aggacgggat cctcagcgac gagatctact gccccccaga gacagccgtg       480
     ctcctgggct cctatgccgt tcaggccaag ttcggagatt ataacaagga aatgcacaag       540
     tctgggtacc tcagctcgga gcggctgatc ccccagagag tcatggacca acacaagctc       600
     agcagggacc agtgggagga ccggatccag gtgtggcacg cggaacaccg agggatgctc       660
     aaggacagtg ctatgctaga atacctgaag attgcccagg acctggaaat gtatgggatc       720
     aactatttcg agatcaaaaa caagaaagga acagaccttt ggcttggagt cgatgccctt       780
     ggacttaaca tttatgagaa agatgacaag ttgaccccaa agatcggctt cccttggagt       840
     gagatcagga acatctcttt caacgacaag aagtttgtca ttaagcccat cgacaagaag       900
     gcacctgact ttgtgttcta cgccccgcgc ctgagaatta acaagcggat cctgcagctc       960
     tgcatgggga accatgagct gtacatgcgc cgcaggaagc ccgacaccat cgaggtgcag      1020
     cagatgaagg cccaggctcg ggaggagaag caccagaagc agctagagcg acagcagttg      1080
     gaaaccgaga agaagaggcg agagacggtg gagagagaaa aggagcagat gctccgggag      1140
     aaggaggagc tgatgcttcg gctgcaggac tacgagcaga agaccaagag ggcggagaaa      1200
     gagctctccg agcagattga gaaggccctc caactggagg aagagaggag gcgagcccag      1260
     gaggaggctg aacgtctgga ggccgaccgc atggccgccc tgcgggccaa ggaagaactc      1320
     gagagacagg cgcaggatca gataaagagc caggagcagc tggctgcaga gctggcagag      1380
     tacacggcca agatcgcact gctggaggag gcgcggaggc gcaaggagga cgaggtagaa      1440
     gagtggcagc accgggctaa agaagcccag gacgacctgg tgaagaccaa agaggagctg      1500
     cacctggtga tgacggcccc accgccccca ccgcccccag tgtatgagcc tgtgaattac      1560
     cacgtgcagg agggactgca ggacgaggga gcagagccta tgggctacag tgccgagctc      1620
     tccagtgagg gcatcctgga tgaccgcaac gaggagaagc ggatcacaga ggcagagaag      1680
     aatgagcgcg tgcagcggca gctgctgacc ctgagcaatg agttgtccca ggcccgggat      1740
     gagaacaaga ggacccacaa tgacatcatc cacaacgaga acatgcggca aggcagggac      1800
     aagtataaga cgctgcggcg aatcaggcag ggcaacacca agcaacgcat tgacgagttc      1860
     gaggccatgt agaggccagg ctgggaccaa gggcagaggg cacctcactg caggcaggtg      1920
     tcacacttgg ctctttagtt ctcttaagtt tagacacccc cttgctgtgt tccagtccct      1980
     taaagagcag ttacggggcc tgcattctgc cccgagaccc agtgggctcc tccttggttc      2040
     cttctaattg tatcacatag tgccaaacag gtcagattta atgacagtta ccgaatcact      2100
     tcctgtttgg agcagggatt cggagggctg gccctcatga agcaagattc attgtcactg      2160
     ggacagcact gtggctcacg ggtgccatac ttttctctag ttttacaatg agctcaaatc      2220
     gattttgttc ttgattttta tgaaggatcc atctctgtgt attgaggggt aaaaatgatt      2280
     ttgaaatttg agtctaaagc atgcccccac agagtctcct tcctccagac cgctggcaga      2340
     gtctccaggg gtccttcaga gtgtacggta caggactctc cgatacaaaa ttctcatgct      2400
     tatctgttag catacattgt tggacttata tatctaatga tctgctatag aggatagtat      2460
     ttatatataa gcgataatat gggtttgtaa cattagtttt aaaaaaggga aagttttgtt      2520
     ctgtatattt tgttaccttt tacagaataa aagaattcaa cattaagaac catgtaaccg      2580
     agacacttga tctgacacag gggcagtcgg gaaaccgatg actgcagtaa tcaccactgt      2640
     acaaaaatgt tagtgggttt tgtgcacgta aaatgcacac ttccatttcc tgtcagtttc      2700
     ttatttg                                                                2707
//

If you have problems or comments...

PBIL Back to PBIL home page