(data stored in ACNUC31108 zone)

EMBL: AK003691

ID   AK003691; SV 1; linear; mRNA; HTC; MUS; 1073 BP.
XX
AC   AK003691;
XX
DT   08-FEB-2001 (Rel. 66, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 21)
XX
DE   Mus musculus 18-day embryo whole body cDNA, RIKEN full-length enriched
DE   library, clone:1110014F12 product:weakly similar to PLATELET-ENDOTHELIAL
DE   TETRASPAN ANTIGEN 3 (PETA-3) (GP27) (MEMBRANE GLYCOPROTEIN SFA-1) (CD151
DE   ANTIGEN) [Homo sapiens], full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1073
RA   Adachi J., Aizawa K., Akahira S., Akimura T., Arai A., Aono H., Arakawa T.,
RA   Bono H., Carninci P., Fukuda S., Fukunishi Y., Furuno M., Hanagaki T.,
RA   Hara A., Hayatsu N., Hiramoto K., Hiraoka T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Izawa M., Kasukawa T., Kato H., Kawai J., Kojima Y.,
RA   Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T., Miyazaki A.,
RA   Nishi K., Nomura K., Numazaki R., Ohno M., Okazaki Y., Okido T., Owa C.,
RA   Saito H., Saito R., Sakai C., Sakai K., Sano H., Sasaki D., Shibata K.,
RA   Shibata Y., Shinagawa A., Shiraki T., Sogabe Y., Suzuki H., Tagami M.,
RA   Tagawa A., Takahashi F., Tanaka T., Tejima Y., Toya T., Yamamura T.,
RA   Yasunishi A., Yoshida K., Yoshino M., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (10-JUL-2000) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 77268288a12c3ec58b536f539a320dc6.
DR   Ensembl-Gn; ENSMUSG00000030351; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0031317; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0031288; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0031216; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0031295; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031019; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0031752; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0030400; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0030980; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0031136; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0031085; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0031216; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031124; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0031787; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030115; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0030485; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000032501; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0080319; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0080398; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0080320; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0080335; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0079959; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0080802; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0080533; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0079910; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0080067; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0079942; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0080105; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0079960; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0081067; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0079964; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0079051; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=1110014F12
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1073
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="18-day embryo"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="1110014F12"
FT                   /tissue_type="whole body"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        121..882
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="putative"
FT                   /note="weakly similar to PLATELET-ENDOTHELIAL TETRASPAN
FT                   ANTIGEN 3 (PETA-3) (GP27) (MEMBRANE GLYCOPROTEIN SFA-1)
FT                   (CD151 ANTIGEN) [Homo sapiens] (SWISSPROT|P48509, evidence:
FT                   FASTY, 59.2%ID, 94%length, match=714)"
FT                   /db_xref="GOA:Q9D1D1"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="MGI:MGI:1915748"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9D1D1"
FT                   /protein_id="BAB22942.1"
FT                   /translation="MAHCKTEQDDWLLAHLKYLLFIFNFFFWVGGAAVMAVGIWTLVEK
FT                   SGYLSILASSTFAASAYILIFVGGLVMTTGFLGFGAIIREQKSCLSTYFCLLLVIFLVE
FT                   LVAGVLAHVYYQRLSDELKWHLNSTLTEHYGQPRAAEITASVDRLQQDFKCCGSNSSAD
FT                   WQHSAYILSQEALGRQVPDSCCKTVVARCGQRAHPSNIYKVEGGCMAKLEQFVADHLLL
FT                   MGAVGIGVACLQICGMVLTCCLHRRLQQQFY"
XX
SQ   Sequence 1073 BP; 204 A; 320 C; 318 G; 231 T; 0 other;
     gagtgggcaa ggagcgcagg gtggagcggg cggctgtggc caggacagcc acaatcacag        60
     ctccggattc ccgatccctc gctgcatcca gcctggcggt tttggccggg tccagccgcc       120
     atggcgcact gcaagacaga gcaggatgac tggctgctgg cccacctgaa gtacctgctc       180
     ttcatcttca acttcttctt ctgggtaggt ggggcagccg tcatggccgt gggtatctgg       240
     acactggtgg agaagagcgg ttacctcagc atcttggcct ccagcacgtt cgctgcctct       300
     gcctacatcc tcattttcgt tggtggtctt gtcatgacaa ctggcttcct gggctttggg       360
     gccatcatcc gggagcagaa gagctgcctc tccacatatt tctgcctgct gctggtcatc       420
     ttccttgtgg agctggtggc aggggtcctg gcacatgtgt actaccagag gctgagtgac       480
     gagctgaagt ggcacctgaa cagcaccctg actgagcact acggacagcc cagggccgca       540
     gagatcacag cctcggtgga ccggctgcag caggacttca aatgctgtgg cagtaacagc       600
     tcagccgact ggcagcacag cgcgtacatc ttgtctcagg aagccctggg tcgccaggtg       660
     cccgacagct gctgcaagac agtggtggcc cgctgtggtc agcgagccca cccctccaac       720
     atctacaagg tagagggagg ctgtatggcc aagctggaac agttcgtggc tgaccacctg       780
     ctgctcatgg gagcggtggg tattggggta gcctgtcttc agatctgtgg gatggtcctc       840
     acctgctgct tgcaccgaag gctccagcaa caattttatt aaaggacacc catgtaccct       900
     gctgactggc ccacccaagg gaccacatct ccacttcctg aaccaggcct gcaaagtcat       960
     cgctggggct gtggactcgc tccaccctat gcagaggcca ccaaatgtct gtggttgtgg      1020
     ttcctgtgca tcccgactgg caggggcctc agctaactcc tccattccta agt             1073
//

If you have problems or comments...

PBIL Back to PBIL home page