(data stored in ACNUC23059 zone)

EMBL: AK004852

ID   AK004852; SV 1; linear; mRNA; HTC; MUS; 1292 BP.
XX
AC   AK004852;
XX
DT   08-FEB-2001 (Rel. 66, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 21)
XX
DE   Mus musculus adult male liver cDNA, RIKEN full-length enriched library,
DE   clone:1300002F15 product:CDK2 (cyclin-dependent kinase 2)-associated
DE   protein 1, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1292
RA   Adachi J., Aizawa K., Akahira S., Akimura T., Arai A., Aono H., Arakawa T.,
RA   Bono H., Carninci P., Fukuda S., Fukunishi Y., Furuno M., Hanagaki T.,
RA   Hara A., Hayatsu N., Hiramoto K., Hiraoka T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Izawa M., Kasukawa T., Kato H., Kawai J., Kojima Y.,
RA   Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T., Miyazaki A.,
RA   Nishi K., Nomura K., Numazaki R., Ohno M., Okazaki Y., Okido T., Owa C.,
RA   Saito H., Saito R., Sakai C., Sakai K., Sano H., Sasaki D., Shibata K.,
RA   Shibata Y., Shinagawa A., Shiraki T., Sogabe Y., Suzuki H., Tagami M.,
RA   Tagawa A., Takahashi F., Tanaka T., Tejima Y., Toya T., Yamamura T.,
RA   Yasunishi A., Yoshida K., Yoshino M., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (10-JUL-2000) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 07b8bb050016d7037654fa6aac3a2f60.
DR   Ensembl-Gn; ENSMUSG00000029394; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000078154; mus_musculus.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029786; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030522; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029893; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030563; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028909; mus_musculus_pwkphj.
DR   Ensembl-Tr; ENSMUST00000031341; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000104959; mus_musculus.
DR   Ensembl-Tr; MGP_C3HHeJ_T0074066; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0074898; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0074061; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0075131; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0074064; mus_musculus_pwkphj.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=1300002F15
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1292
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="1300002F15"
FT                   /tissue_type="liver"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        302..646
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="CDK2 (cyclin-dependent kinase 2)-associated protein
FT                   1 (MGD|MGI:1202069, evidence: Direct assignment)"
FT                   /note="putative"
FT                   /db_xref="GOA:O35207"
FT                   /db_xref="InterPro:IPR017266"
FT                   /db_xref="MGI:MGI:1202069"
FT                   /db_xref="UniProtKB/Swiss-Prot:O35207"
FT                   /protein_id="BAB23616.1"
FT                   /translation="MSYKPNLTAHMPAAALNAGSVHSPSTSMATSSQYRQLLSDYGPPS
FT                   LGYTQGTGNSQVPQSKYAELLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARSLVREC
FT                   LAETERNARS"
FT   regulatory      1274..1279
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      1292
FT                   /note="putative"
XX
SQ   Sequence 1292 BP; 275 A; 381 C; 358 G; 278 T; 0 other;
     gggtccggcc ccggcccagc accgaccggc tgggctcaaa gtttgcggcc gcccatgcgc        60
     cgcgccctcg atgtatgggt gatctactgc ggcggcggcg gcggcggcgg cggcagggtg       120
     agggacggcc atatttgccg gcgcggcccg agccggcgac aacaaaaagt gcgcgggctc       180
     ccggcgggcg ctcggacggc tgcggggacg tggggccgcc cggcgcgggc ctcggcctcg       240
     gcctcgccgg cgcgctcgcg gcctggcccg gctctgctcg gcgcgcccgc cgcccgcggg       300
     gatgtcgtac aagccgaact tgaccgcgca catgcccgcc gccgccctca acgccggaag       360
     tgtccactca ccctctacta gcatggcgac ctcctcccaa tatcgccagc tgctgagtga       420
     ctatgggcct ccatcgctag gctacaccca gggaactgga aatagccagg tgcctcagag       480
     taaatatgca gagctgctgg ccatcattga agagttgggg aaagagatca gaccgacgta       540
     tgcagggagc aagagcgcca tggagaggct aaaacgaggc atcattcatg cccggagcct       600
     ggttcgggag tgcttggctg aaacggaacg gaatgccagg tcctagcccc tggctggtct       660
     gaaggcccat ctcactaccc cgtggagatg agaggctttg tgcaaaatgg cagtcatttt       720
     tctaccacag tcattaagct ctgaacccac actcaaaaga ttgggaggac attttgcagt       780
     aactgacgat gtgcatttta agtagttagg aatgacccag ctcttttttt ctttccaaac       840
     atttgaaaga tgtttgtgaa gccacttcac agcaagctat tgtttgtccc caaataccag       900
     tgtcccctct aacctgcctt tggatacgca tcaccccagc tgacttcctt tccctgagct       960
     cacctgcctc cgaggagttg agtgcaaacc acagcgcctt tgctcagtag ctggcccgcc      1020
     tgtgtacagt gtagaccctg cttcatggag cttctctgcc taagcgtttg catgactgag      1080
     tgcttggaag tcaatcttta aaatgcacag gttacacatg cagaagaaag agccatctac      1140
     ccaacctccc aagcaccctg cagatgtcca tcctgaggct gtagatctca gttctgtgtt      1200
     tactgtgagc ccatcacaac atctggaaga aagcgactga aactgttgca tctttgtatt      1260
     tattacttga tgtaataaag cttattttca tt                                    1292
//

If you have problems or comments...

PBIL Back to PBIL home page