(data stored in ACNUC13479 zone)

EMBL: AK004854

ID   AK004854; SV 1; linear; mRNA; HTC; MUS; 3073 BP.
XX
AC   AK004854;
XX
DT   08-FEB-2001 (Rel. 66, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 21)
XX
DE   Mus musculus adult male liver cDNA, RIKEN full-length enriched library,
DE   clone:1300002I11 product:signal recognition particle receptor, B subunit,
DE   full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3073
RA   Adachi J., Aizawa K., Akahira S., Akimura T., Arai A., Aono H., Arakawa T.,
RA   Bono H., Carninci P., Fukuda S., Fukunishi Y., Furuno M., Hanagaki T.,
RA   Hara A., Hayatsu N., Hiramoto K., Hiraoka T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Izawa M., Kasukawa T., Kato H., Kawai J., Kojima Y.,
RA   Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T., Miyazaki A.,
RA   Nishi K., Nomura K., Numazaki R., Ohno M., Okazaki Y., Okido T., Owa C.,
RA   Saito H., Saito R., Sakai C., Sakai K., Sano H., Sasaki D., Shibata K.,
RA   Shibata Y., Shinagawa A., Shiraki T., Sogabe Y., Suzuki H., Tagami M.,
RA   Tagawa A., Takahashi F., Tanaka T., Tejima Y., Toya T., Yamamura T.,
RA   Yasunishi A., Yoshida K., Yoshino M., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (10-JUL-2000) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 2b4562bfcc1efc31ad82a1a42ddd037f.
DR   Ensembl-Gn; ENSMUSG00000032553; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035194; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0035174; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0035106; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035167; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0034877; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0035687; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034189; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0034846; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0035007; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0034955; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0035083; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0034994; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0035709; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0033896; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034309; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000035157; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0093925; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0094009; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0093962; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0093935; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0093512; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0094449; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0094110; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0093431; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0093641; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0093495; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0093649; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0093471; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0094776; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0093547; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0092509; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=1300002I11
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3073
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="1300002I11"
FT                   /tissue_type="liver"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        40..849
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="putative"
FT                   /note="signal recognition particle receptor, B subunit
FT                   (MGD|MGI:102964 GB|NM_009275, evidence: BLASTN, 100%,
FT                   match=850)"
FT                   /db_xref="GOA:P47758"
FT                   /db_xref="InterPro:IPR019009"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:102964"
FT                   /db_xref="PDB:2FH5"
FT                   /db_xref="PDB:2GO5"
FT                   /db_xref="UniProtKB/Swiss-Prot:P47758"
FT                   /protein_id="BAB23618.1"
FT                   /translation="MASANTRRVGDGAGGAFQPYLDSLRQELQQRDPTLLSVAVALLAV
FT                   LLTLVFWKFIWSRKSSQRAVLFVGLCDSGKTLLFVRLLTGQYRDTQTSITDSSAIYKVN
FT                   NNRGNSLTLIDLPGHESLRFQLLDRFKSSARAVVFVVDSAAFQREVKDVAEFLYQVLID
FT                   SMALKNSPSLLIACNKQDIAMAKSAKLIQQQLEKELNTLRVTRSAAPSTLDSSSTAPAQ
FT                   LGKKGKEFEFSQLPLKVEFLECSAKGGRGDTGSADIQDLEKWLAKIA"
FT   regulatory      3058..3063
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      3073
FT                   /note="putative"
XX
SQ   Sequence 3073 BP; 726 A; 795 C; 803 G; 749 T; 0 other;
     ggtaactttg gcggcccggg aagactacac acctctttca tggcttcggc gaacacccgg        60
     cgagttggcg atggcgccgg tggcgccttc cagccttacc tcgactcctt acgacaggag       120
     ctgcagcaga gggatccgac gctgctctcc gtggcggtgg ctctcctggc ggtgctgctg       180
     acgctggtgt tctggaagtt catctggagc cgaaagagca gtcagagagc tgttctcttc       240
     gttggtctct gtgactctgg gaaaacgttg ctgtttgtca ggttgctaac tggccagtac       300
     agagacacac agacttccat taccgatagt tctgccatat acaaagtcaa caataacagg       360
     ggtaacagcc tgactctgat cgacctcccc gggcatgaga gcttgaggtt tcagctctta       420
     gatcgcttta agtcttcagc tagggctgtg gtgtttgtgg tggacagtgc ggcgttccag       480
     cgggaggtga aagatgtggc cgaatttctg taccaggtcc tcatcgacag catggctctg       540
     aagaactcac cgtccttatt aatagcctgc aataagcaag atatcgcaat ggcaaaatca       600
     gcgaagttga tccagcagca gcttgagaag gagctcaaca ccttacgagt cacccggtcc       660
     gcggctccca gcacactgga cagttccagc accgcacctg ctcagttggg gaagaaaggc       720
     aaagaatttg aattttccca gttgccactc aaagtggagt tcctggagtg tagtgccaag       780
     ggtggacgag gggacactgg ctctgctgac atccaggact tggagaagtg gctggccaag       840
     attgcctgag gagcatcgct ggccacaagc gttggtcatg tgagactgac cctgcagttt       900
     gagaaagggc ggtggtggtg tggactgata aagagggggc atgtcgttga agcatttctt       960
     gagttcttga aacaattgta ccacccccac cccacccccg tcagctcctt tctcagctag      1020
     tcctttctta attcccatat tctttctccc tttgctaggt gttaggtgta gcatcatgtt      1080
     agtgtgagac ataacagaga gggcatcgct ttgagagtag ggtcgcatct gagaagtcct      1140
     tgtctcctgc ctctgtgttg gtcccttttc ctgggaccag atctgcctgc ttgtggaata      1200
     agtgaacttg cagttgcccc tggtgtaggc ataatacagt gtcagttctt agtggagtct      1260
     ggggtgtgaa ggtctacagt gaagacagct tcaaagccac aggcacagct gacagtgtgt      1320
     ccttcacggg ctcagtgacc atcccacacc accctagctg acagtgtgtc cttcacgggc      1380
     tcggtgacca tcccacacca ccctagctga cagtgtgtcc ttcacgggct cggtgaccat      1440
     cccacaccac cctagcggac agtgtgtcct tcacaggctc ggtgaccatc ccacaccacc      1500
     ctagctgaca gtgtgtcctt catgggctcg gtgaccatcc cacaccaccc tagctgacag      1560
     tgtgtccttc acgggctcgg tgaccatccc acaccaccct agctgacagt gtgtccttca      1620
     cgggctcggt gaccatcccc acaccaccct aggttcaaaa gctgccgcaa ccccgaagag      1680
     tcaccctcac aaggtggctc taggagccaa atccccagac actcctaggt tagtgttcta      1740
     gaggctccac tggggagagc agggagacag cacactgctg catcgggcgt gcgtgagccc      1800
     aggctgtccc ctgtgctact tgatcagctc ctgttgtgtc accccagcta gagtgctatg      1860
     gaacaataca aactgaagat gtccactgtg cattttaaat acatatttat tcatgatgct      1920
     ttaaaaaatg ttaccttttt aaagtgatgc tgtcttcaac atttgtgttc tcattgcttt      1980
     tataaatgac tggtatcttg ataaatgact atactgaaag cattgagtca aatgatgagt      2040
     acaagtggga acctgagcta gaattgaacc ccagctccag gttactgagc ctacagatcg      2100
     ctgcatatat gagattcttg gtctcgtctc acactcagag tcaggcttca ctaaagccac      2160
     actaaagaga caggcagagc attgactcag gtgcagtgct cagggaatat gtgtggcgct      2220
     ctgggctggc ctggaccagt gagagggaca ggataaacac acaggtgttc tctgtgcaga      2280
     ccagcccaag cctctgcctg ctgacacatg gcctccctgt gggtcacctg ggctgataat      2340
     agagtcccag accatgattc ccatcaagta ctcagctccc cactcctaaa atatctactg      2400
     gccttgctta tggtgtatga gacagataca gcacagcaca ggacagataa gccatgagat      2460
     gactcagttc tcactgggag gcagtattgc tgctaggatt cttactgccc tttgcacact      2520
     gctgttcatg ttggtcacgg acaaatggga agggcacgat gaaggacgtt cacatcacag      2580
     taggtgctca tcaaaaaaac ctttcagtta gaaaatgtgt tcgctggcct cccttttgtc      2640
     tgcataataa agtgatttta cttagtggga gaatcagtac atcaaaaaag tgacaaggat      2700
     ggagagcaag gataaatgtt atttatttat ttatagcctg tgtcctgagc aaaaggtaag      2760
     ctgtgcaggg ctgggaacca ggttagtaga atgcctacct ggaacgcatg ggtctggctt      2820
     tgctgtgggc tgctgtaaaa gccagctcta aacaggcagc cgcagcaaag attctatgtc      2880
     tggactcttc catggagcca cggcagaagc agcttctcac tgctaggtgc cttgtggtct      2940
     ctcgggaggc cttggcccct gccactgctt cccagggcct ccagcacctc ctgacgtgag      3000
     ctgttctatc agaggggagg ggaggcagtg gcccagccat tgagctattt caggcacaat      3060
     aaaatataag gct                                                         3073
//

If you have problems or comments...

PBIL Back to PBIL home page