(data stored in ACNUC7421 zone)

EMBL: AK005030

ID   AK005030; SV 1; linear; mRNA; HTC; MUS; 1247 BP.
XX
AC   AK005030;
XX
DT   08-FEB-2001 (Rel. 66, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 22)
XX
DE   Mus musculus adult male liver cDNA, RIKEN full-length enriched library,
DE   clone:1300017C12 product:PP6 homolog [Homo sapiens], full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1247
RA   Adachi J., Aizawa K., Akahira S., Akimura T., Arai A., Aono H., Arakawa T.,
RA   Bono H., Carninci P., Fukuda S., Fukunishi Y., Furuno M., Hanagaki T.,
RA   Hara A., Hayatsu N., Hiramoto K., Hiraoka T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Izawa M., Kasukawa T., Kato H., Kawai J., Kojima Y.,
RA   Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T., Miyazaki A.,
RA   Nishi K., Nomura K., Numazaki R., Ohno M., Okazaki Y., Okido T., Owa C.,
RA   Saito H., Saito R., Sakai C., Sakai K., Sano H., Sasaki D., Shibata K.,
RA   Shibata Y., Shinagawa A., Shiraki T., Sogabe Y., Suzuki H., Tagami M.,
RA   Tagawa A., Takahashi F., Tanaka T., Tejima Y., Toya T., Yamamura T.,
RA   Yasunishi A., Yoshida K., Yoshino M., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (10-JUL-2000) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 7754e1472a7685aec498b65f71738e69.
DR   Ensembl-Gn; ENSMUSG00000028601; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028549; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0028512; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0028459; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028531; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0028245; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028971; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027681; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0028214; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0028362; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0028330; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0028463; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028356; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029007; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027407; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027762; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000052999; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000116307; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000116309; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0066814; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0066873; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0066763; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0066791; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0066457; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0067263; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0066835; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0066405; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0066540; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0066464; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0066644; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0066453; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0067448; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0066374; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0065658; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=1300017C12
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1247
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="1300017C12"
FT                   /tissue_type="liver"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        184..924
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="PP6 homolog [Homo sapiens] (SPTR|AAG23793, evidence:
FT                   FASTY, 91.1%ID, 100%length, match=405)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q3TLP5"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="MGI:MGI:1289238"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3TLP5"
FT                   /protein_id="BAB23757.1"
FT                   /translation="MNGPNARNALGNVFVSELLEALAQLREDQQVRVLLFRSAVKGVFC
FT                   AGADLKEREQMSDVEVGTFVQRLRGLMSEIAAFPVPTIAAMDGFALGGGLELALACDLR
FT                   IAASSAVMGLIETTRGLLPGAGGTQRLPRCLGVALAKELIFTGRRLNGAQARELGLVNH
FT                   AVAQNEEGNAAYHRALALAQEILPQAPIAVRLGKVAIDRGMEVDIASGMAIEQMCYAQN
FT                   IPTQDRLEGMAAFREKRAPKFVGK"
FT   regulatory      1227..1232
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      1247
FT                   /note="putative"
XX
SQ   Sequence 1247 BP; 270 A; 347 C; 361 G; 269 T; 0 other;
     ggttctccgc gccaccttgc cggcctgctc cccgatgcta cgcgtactgc ccgcgcgctg        60
     cgcctcccgt gctcctggag gttctcgggg gcccgggact gcgcctctca cgcgacgacc       120
     aggacacccg aaatccaagt gcaggctctg acaggtccca accaaggaat cactgagatt       180
     ctgatgaacg gacctaatgc ccgcaatgcc ttggggaatg tgtttgttag tgagctgctg       240
     gaagctctgg cccagcttcg ggaagaccag caagtccggg tcctgctctt cagaagtgcg       300
     gtgaagggag tgttctgtgc aggtgcagac ctgaaggagc gggagcagat gagtgatgtg       360
     gaggtgggga cctttgtcca gcggctccga ggcctgatga gtgagatcgc agccttccct       420
     gtgcccacca ttgcagccat ggatgggttt gccttaggcg ggggcttgga acttgccctg       480
     gcctgtgacc tccgaatagc agcttcttcg gctgtcatgg ggctaattga gaccactcga       540
     ggacttctcc caggagcagg agggactcag aggctgcctc gctgcctggg cgtggcccta       600
     gcgaaggagc tcatcttcac aggccggcga ctgaacgggg cacaggcccg tgagttgggc       660
     ctggtaaatc atgccgtggc tcagaatgag gagggtaacg ctgcctacca ccgggccctg       720
     gcactggcac aggagatcct gccccaggct cccattgctg tgcgcctggg caaagttgcc       780
     atcgacagag gaatggaggt ggacattgca tcagggatgg ccatagaaca gatgtgctat       840
     gcccagaaca tcccaaccca ggacaggctg gaaggaatgg cagccttcag ggagaaacga       900
     gctcccaaat ttgtgggcaa gtgacccagc taactttaag cacacaccat aaagtctaga       960
     tcatccagag aaccaaggta ctgaccatgc agtgcactgc caccttccat actgctcacc      1020
     ttggctagtg actggactct ctgcattcaa aaacttcggg tctttgtcat tggctctgat      1080
     caccatggat agagcaatga ggacttactt actctcacag agtttctttg agttagtgtc      1140
     aggagccctc cagctctctg taacgcaagg ggaattctgg acaaactatt taacctctct      1200
     atcagtctct ctgatatccc tgtgttaata aacatgctgc aactgtt                    1247
//

If you have problems or comments...

PBIL Back to PBIL home page