(data stored in ACNUC13479 zone)

EMBL: AK007859

ID   AK007859; SV 1; linear; mRNA; HTC; MUS; 922 BP.
XX
AC   AK007859;
XX
DT   08-FEB-2001 (Rel. 66, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 20)
XX
DE   Mus musculus 10 day old male pancreas cDNA, RIKEN full-length enriched
DE   library, clone:1810054I14 product:signal recognition particle receptor, B
DE   subunit, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-922
RA   Adachi J., Aizawa K., Akahira S., Akimura T., Arai A., Aono H., Arakawa T.,
RA   Bono H., Carninci P., Fukuda S., Fukunishi Y., Furuno M., Hanagaki T.,
RA   Hara A., Hayatsu N., Hiramoto K., Hiraoka T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Izawa M., Kasukawa T., Kato H., Kawai J., Kojima Y.,
RA   Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T., Miyazaki A.,
RA   Nishi K., Nomura K., Numazaki R., Ohno M., Okazaki Y., Okido T., Owa C.,
RA   Saito H., Saito R., Sakai C., Sakai K., Sano H., Sasaki D., Shibata K.,
RA   Shibata Y., Shinagawa A., Shiraki T., Sogabe Y., Suzuki H., Tagami M.,
RA   Tagawa A., Takahashi F., Tanaka T., Tejima Y., Toya T., Yamamura T.,
RA   Yasunishi A., Yoshida K., Yoshino M., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (10-JUL-2000) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; ce8cdccda6cee4cf520883dc149f0ec0.
DR   Ensembl-Gn; ENSMUSG00000032553; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035194; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0035174; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0035106; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035167; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0034877; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0035687; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034189; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0034846; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0035007; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0034955; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0035083; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0034994; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0035709; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0033896; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034309; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000035157; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0093925; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0094009; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0093962; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0093935; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0093512; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0094449; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0094110; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0093431; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0093641; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0093495; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0093649; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0093471; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0094776; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0093547; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0092509; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=1810054I14
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..922
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="10 day old"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="1810054I14"
FT                   /tissue_type="pancreas"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        13..822
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="putative"
FT                   /note="signal recognition particle receptor, B subunit
FT                   (MGD|MGI:102964 GB|NM_009275, evidence: BLASTN, 100%,
FT                   match=841)"
FT                   /db_xref="GOA:P47758"
FT                   /db_xref="InterPro:IPR019009"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:102964"
FT                   /db_xref="PDB:2FH5"
FT                   /db_xref="PDB:2GO5"
FT                   /db_xref="UniProtKB/Swiss-Prot:P47758"
FT                   /protein_id="BAB25311.1"
FT                   /translation="MASANTRRVGDGAGGAFQPYLDSLRQELQQRDPTLLSVAVALLAV
FT                   LLTLVFWKFIWSRKSSQRAVLFVGLCDSGKTLLFVRLLTGQYRDTQTSITDSSAIYKVN
FT                   NNRGNSLTLIDLPGHESLRFQLLDRFKSSARAVVFVVDSAAFQREVKDVAEFLYQVLID
FT                   SMALKNSPSLLIACNKQDIAMAKSAKLIQQQLEKELNTLRVTRSAAPSTLDSSSTAPAQ
FT                   LGKKGKEFEFSQLPLKVEFLECSAKGGRGDTGSADIQDLEKWLAKIA"
XX
SQ   Sequence 922 BP; 207 A; 228 C; 276 G; 211 T; 0 other;
     gacacctctt tcatggcttc ggcgaacacc cggcgagttg gcgatggcgc cggtggcgcc        60
     ttccagcctt acctcgactc cttacgacag gagctgcagc agagggatcc gacgctgctc       120
     tccgtggcgg tggctctcct ggcggtgctg ctgacgctgg tgttctggaa gttcatctgg       180
     agccgaaaga gcagtcagag agctgttctc ttcgttggtc tctgtgactc tgggaaaacg       240
     ttgctgtttg tcaggttgct aactggccag tacagagaca cacagacttc cattaccgat       300
     agttctgcca tatacaaagt caacaataac aggggtaaca gcctgactct gatcgacctc       360
     cccgggcatg agagcttgag gtttcagctc ttagatcgct ttaagtcttc agctagggct       420
     gtggtgtttg tggtggacag tgcggcgttc cagcgggagg tgaaagatgt ggccgaattt       480
     ctgtaccagg tcctcatcga cagcatggct ctgaagaact caccgtcctt attaatagcc       540
     tgcaataagc aagatatcgc aatggcaaaa tcagcgaagt tgatccagca gcagcttgag       600
     aaggagctca acaccttacg agtcacccgg tccgcggctc ccagcacact ggacagttcc       660
     agcaccgcac ctgctcagtt ggggaagaaa ggcaaagaat ttgaattttc ccagttgcca       720
     ctcaaagtgg agttcctgga gtgtagtgcc aagggtggac gaggggacac tggctctgct       780
     gacatccagg acttggagaa gtggctggcc aagattgcct gaggagcatc gctggccaca       840
     agcgttggtc atgtgagact gaccctgcag tttgagaaag ggcggtggtg gtgtggactg       900
     ataaagaggg ggcatgtcgt tg                                                922
//

If you have problems or comments...

PBIL Back to PBIL home page