(data stored in ACNUC13479 zone)

EMBL: AK008383

ID   AK008383; SV 1; linear; mRNA; HTC; MUS; 1976 BP.
XX
AC   AK008383;
XX
DT   08-FEB-2001 (Rel. 66, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 21)
XX
DE   Mus musculus adult male small intestine cDNA, RIKEN full-length enriched
DE   library, clone:2010110K12 product:signal recognition particle receptor, B
DE   subunit, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1976
RA   Adachi J., Aizawa K., Akahira S., Akimura T., Arai A., Aono H., Arakawa T.,
RA   Bono H., Carninci P., Fukuda S., Fukunishi Y., Furuno M., Hanagaki T.,
RA   Hara A., Hayatsu N., Hiramoto K., Hiraoka T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Izawa M., Kasukawa T., Kato H., Kawai J., Kojima Y.,
RA   Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T., Miyazaki A.,
RA   Nishi K., Nomura K., Numazaki R., Ohno M., Okazaki Y., Okido T., Owa C.,
RA   Saito H., Saito R., Sakai C., Sakai K., Sano H., Sasaki D., Shibata K.,
RA   Shibata Y., Shinagawa A., Shiraki T., Sogabe Y., Suzuki H., Tagami M.,
RA   Tagawa A., Takahashi F., Tanaka T., Tejima Y., Toya T., Yamamura T.,
RA   Yasunishi A., Yoshida K., Yoshino M., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (10-JUL-2000) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; a244e26f5b0925ed62e755183546fb08.
DR   Ensembl-Gn; ENSMUSG00000032553; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035194; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0035174; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0035106; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035167; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0034877; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0035687; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034189; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0034846; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0035007; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0034955; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0035083; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0034994; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0035709; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0033896; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034309; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000035157; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0093925; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0094009; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0093962; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0093935; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0093512; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0094449; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0094110; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0093431; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0093641; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0093495; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0093649; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0093471; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0094776; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0093547; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0092509; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=2010110K12
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1976
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="2010110K12"
FT                   /tissue_type="small intestine"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        50..859
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="putative"
FT                   /note="signal recognition particle receptor, B subunit
FT                   (MGD|MGI:102964)"
FT                   /db_xref="GOA:P47758"
FT                   /db_xref="InterPro:IPR019009"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:102964"
FT                   /db_xref="PDB:2FH5"
FT                   /db_xref="PDB:2GO5"
FT                   /db_xref="UniProtKB/Swiss-Prot:P47758"
FT                   /protein_id="BAB25638.1"
FT                   /translation="MASANTRRVGDGAGGPFQPYLDSLRQELQQRDPTLLSVAVALLAV
FT                   LLTLVFWKFIWSRKSSQRAVLFVGLCDSGKTLLFVRLLTGQYRDTQTSITDSSAIYKVN
FT                   NNRGNSLTLIDLPGHESLRFQLLDRFKSSARAVVFVVDSAAFQREVKDVAEFLYQVLID
FT                   SMALKNSPSLLIACNKQDIAMAKSAKLIQQQLEKELNTLRVTRSAAPSTLDSSSTAPAQ
FT                   LGKKGKEFEFSQLPLKVEFLECSAKGGRGDTGSADIQDLEKWLAKIA"
XX
SQ   Sequence 1976 BP; 445 A; 529 C; 515 G; 487 T; 0 other;
     gctagagcca cgtaactttg gcggcccggg aagactacac acctctttca tggcttcggc        60
     gaacacccgg cgagttggcg atggcgccgg tggccctttc cagccttacc tcgactcctt       120
     acgacaggag ctgcagcaga gggatccgac gctgctctcc gtggcggtgg ctctcctggc       180
     ggtgctgctg acgctggtgt tctggaagtt catctggagc cgaaagagca gtcagagagc       240
     tgttctcttc gttggtctct gtgactctgg gaaaacgttg ctgtttgtca ggttgctaac       300
     tggccagtac agagacacac agacttccat taccgatagt tctgccatat acaaagtcaa       360
     caataacagg ggtaacagcc tgactctgat cgacctcccc gggcatgaga gcttgaggtt       420
     tcagctctta gatcgcttta agtcttcagc tagggctgtg gtgtttgtgg tggacagtgc       480
     ggcgttccag cgggaggtga aagatgtggc cgaatttctg taccaggtcc tcatcgacag       540
     catggctctg aagaactcac cgtccttatt aatagcctgc aataagcaag atatcgcaat       600
     ggcaaaatca gcgaagttga tccagcagca gcttgagaag gagctcaaca ccttacgagt       660
     cacccggtcc gcggctccca gcacactgga cagttccagc accgcacctg ctcagttggg       720
     gaagaaaggc aaagaatttg aattttccca gttgccactc aaagtggagt tcctggagtg       780
     tagtgccaag ggtggacgag gggacactgg ctctgctgac atccaggact tggagaagtg       840
     gctggccaag attgcctgag gagcatcgct ggccacaagc gttggtcatg tgagactgac       900
     cctgcagttt gagaaagggc ggtggtggtg tggactgata aagagggggc atgtcgttga       960
     agcatttctt gagttcttga aacaattgta ccacccccac cccacccccg tcagctcctt      1020
     tctcagctag tcctttctta attcccatat tctttctccc tttgctaagt gttaggtgta      1080
     gcatcatgtt agtgtgagac ataacagaga gggcatcgct ttgagagtaa ggtcgcatct      1140
     gagaagtcct tgtctcctgc ctctgtgttg gtcccttttt ctgggaccag atctgcctgc      1200
     tcgtggaata agtgaactgg cagtgcccct ggtgtaggca taatacagtg tcagttctta      1260
     gtggagtctg gggtgtgaag gtctacagtg aagacagctt caaagccaca ggcacagctg      1320
     acagtgtgtc gttcacgggc tcagtgacca tcccacacca ccctagctga cagtgtgtcc      1380
     ttcacgggct cggtgaccat cccacaccac cctagctgac agtgtgtcct tcacgggctc      1440
     ggtgaccatc ccacaccacc ctagctgaca gtgtgtcctt cacaggctcg gtgaccatcc      1500
     cacaccaccc tagctgacag tgtgtccttc atgagctcgg tgaccatccc acaccaccct      1560
     agctgacagt gtgtccttca cgggctcggt gaccatcccc acaccaccct aggttcaaaa      1620
     gctgccgcaa ccccgaagag tcaccctcac aaggtggctc taggagccaa atccccagac      1680
     actcctaggt tagtgttcta gaggctccac tggggagagc agggagacag cacactgctg      1740
     cctcgggcgt gcgtgagccc aggctgtccc ctgtgctact tgatcagctc ctgttgtgtc      1800
     accccagcta gagtgctatg gaacaataca aactgaagat gtccactgtg cattttaaat      1860
     acatatttat tcatgatgct ttaaaaaatg ttaccttttt aaagtgatgc tgtcttcaac      1920
     atttgtgttc tcattgcttt tataaatgac tggtatcttg ataaatgact ataccg          1976
//

If you have problems or comments...

PBIL Back to PBIL home page