(data stored in ACNUC9543 zone)

EMBL: AK008531

ID   AK008531; SV 1; linear; mRNA; HTC; MUS; 507 BP.
XX
AC   AK008531;
XX
DT   08-FEB-2001 (Rel. 66, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 20)
XX
DE   Mus musculus adult male small intestine cDNA, RIKEN full-length enriched
DE   library, clone:2010305L10 product:ribosomal protein L27a, full insert
DE   sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-507
RA   Adachi J., Aizawa K., Akahira S., Akimura T., Arai A., Aono H., Arakawa T.,
RA   Bono H., Carninci P., Fukuda S., Fukunishi Y., Furuno M., Hanagaki T.,
RA   Hara A., Hayatsu N., Hiramoto K., Hiraoka T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Izawa M., Kasukawa T., Kato H., Kawai J., Kojima Y.,
RA   Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T., Miyazaki A.,
RA   Nishi K., Nomura K., Numazaki R., Ohno M., Okazaki Y., Okido T., Owa C.,
RA   Saito H., Saito R., Sakai C., Sakai K., Sano H., Sasaki D., Shibata K.,
RA   Shibata Y., Shinagawa A., Shiraki T., Sogabe Y., Suzuki H., Tagami M.,
RA   Tagawa A., Takahashi F., Tanaka T., Tejima Y., Toya T., Yamamura T.,
RA   Yasunishi A., Yoshida K., Yoshino M., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (10-JUL-2000) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 52b462efed5d5e5396fb316436cdb759.
DR   Ensembl-Gn; ENSMUSG00000046364; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032842; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0032826; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0032757; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032830; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0032540; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0033336; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031868; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0032513; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0032665; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0032618; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0032759; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032650; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0033357; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031575; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031981; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000143107; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0085815; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0085891; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0085832; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0085856; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0085415; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0086357; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0085933; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0085358; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0085552; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0085403; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0085598; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0085445; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0086644; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0085338; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0084463; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=2010305L10
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..507
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="2010305L10"
FT                   /tissue_type="small intestine"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        24..470
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="putative"
FT                   /note="ribosomal protein L27a (MGD|MGI:1347076 GB|AK008531,
FT                   evidence: BLASTN, 100%, match=507)"
FT                   /db_xref="GOA:P14115"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="MGI:MGI:1347076"
FT                   /db_xref="UniProtKB/Swiss-Prot:P14115"
FT                   /protein_id="BAB25724.1"
FT                   /translation="MPSRLRKTRKLRGHVSHGHGRIGKHRKHPGGRGNAGGMHHHRINF
FT                   DKYHPGYFGKVGMRHYHLKRNQSFCPTVNLDKLWTLVSEQTRVNAAKNKTGVAPIIDVV
FT                   RSGYYKVLGKGKLPKQPVIVKAKFFSRRAEEKIKGVGGACVLVA"
FT   regulatory      489..494
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      507
FT                   /note="putative"
XX
SQ   Sequence 507 BP; 138 A; 129 C; 136 G; 104 T; 0 other;
     gtttttccct ttctgccacc gccatgccat ccagactgag gaagacccgg aaactccggg        60
     gccacgtgag ccacggccac ggccgcatcg gtaagcaccg caagcaccca ggcggccgcg       120
     ggaatgctgg aggcatgcac caccacagga tcaactttga caaatatcac ccaggttact       180
     ttgggaaagt tggtatgcgg cattaccact tgaagaggaa ccagagcttc tgcccaacag       240
     tcaacctgga taaactgtgg acattggtca gcgagcagac acgggtcaat gcggcaaaaa       300
     acaagactgg agttgctccc atcattgatg ttgttcgatc aggctactac aaagttctgg       360
     gcaagggaaa gctccctaag caacctgtca tcgtgaaggc caaattcttc agcagaagag       420
     ctgaggagaa gattaagggt gttggaggtg cctgtgttct ggtggcttaa aagccacacc       480
     ggaggttaat taaatgctaa cattttc                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page