(data stored in ACNUC5448 zone)

EMBL: AK008844

ID   AK008844; SV 1; linear; mRNA; HTC; MUS; 1323 BP.
XX
AC   AK008844;
XX
DT   08-FEB-2001 (Rel. 66, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 19)
XX
DE   Mus musculus adult male stomach cDNA, RIKEN full-length enriched library,
DE   clone:2210407G14 product:hypothetical Pleckstrin homology (PH) domain
DE   containing protein, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1323
RA   Adachi J., Aizawa K., Akahira S., Akimura T., Arai A., Aono H., Arakawa T.,
RA   Bono H., Carninci P., Fukuda S., Fukunishi Y., Furuno M., Hanagaki T.,
RA   Hara A., Hayatsu N., Hiramoto K., Hiraoka T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Izawa M., Kasukawa T., Kato H., Kawai J., Kojima Y.,
RA   Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T., Miyazaki A.,
RA   Nishi K., Nomura K., Numazaki R., Ohno M., Okazaki Y., Okido T., Owa C.,
RA   Saito H., Saito R., Sakai C., Sakai K., Sano H., Sasaki D., Shibata K.,
RA   Shibata Y., Shinagawa A., Shiraki T., Sogabe Y., Suzuki H., Tagami M.,
RA   Tagawa A., Takahashi F., Tanaka T., Tejima Y., Toya T., Yamamura T.,
RA   Yasunishi A., Yoshida K., Yoshino M., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (10-JUL-2000) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; a5c492a1492ec5f5c6bb1b4807265e13.
DR   Ensembl-Gn; ENSMUSG00000061751; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000076810; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000089655; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114949; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114953; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114954; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114960; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000232157; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=2210407G14
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1323
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="2210407G14"
FT                   /tissue_type="stomach"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        <1..807
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="hypothetical Pleckstrin homology (PH) domain
FT                   containing protein (InterPro|IPR001849, evidence:
FT                   InterPro)"
FT                   /note="putative"
FT                   /note="start codon is not identified"
FT                   /db_xref="GOA:A2CG49"
FT                   /db_xref="InterPro:IPR000219"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001251"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR002017"
FT                   /db_xref="InterPro:IPR003598"
FT                   /db_xref="InterPro:IPR003599"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR013098"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR018159"
FT                   /db_xref="InterPro:IPR028569"
FT                   /db_xref="InterPro:IPR035899"
FT                   /db_xref="InterPro:IPR036028"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="InterPro:IPR036865"
FT                   /db_xref="MGI:MGI:2685385"
FT                   /db_xref="PDB:1WFW"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2CG49"
FT                   /protein_id="BAB25925.1"
FT                   /translation="GMQSRTKERRVFLFEQIVIFSELLRKGSLTPGYMFKRSIKMNYLV
FT                   LEDNVDGDPCKFALMNRETSERVILQAANSDIQQAWVQDINQVLETQRDFLNALQSPIE
FT                   YQRKERSTAVIRSQPPRVPQASPRPYSSGPVGSEKPPKGSSYNPPLPPLKISTSNGSPG
FT                   FDYHQPXDKFDASKQNDLXGCNGTSTMTVIKDYYALKENEICVSQSEVVQVLAVNQQNM
FT                   CLVYQPASDHSPAAKGWVPGSILAPFAKATAAAESSDGSIKTLLKP"
FT   regulatory      1304..1309
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      1323
FT                   /note="putative"
XX
SQ   Sequence 1323 BP; 355 A; 326 C; 298 G; 342 T; 2 other;
     ggcatgcagt cccggaccaa ggagaggcgt gtgtttctct ttgagcagat tgtcatcttc        60
     agtgaactgc tccgaaaggg gtccctcacc ccaggctaca tgttcaaaag aagcatcaag       120
     atgaattact tggtcctgga agacaatgtg gatggtgacc cctgcaaatt tgcactcatg       180
     aacagggaga cttcagaaag ggtcattcta caggctgcca actcagacat ccagcaggcc       240
     tgggtgcagg acatcaacca agtcctagaa acacagaggg acttcttaaa tgcactacag       300
     tcacccattg agtatcagcg gaaggagaga agcacagctg tgatccggtc ccagcccccg       360
     agggttccac aagccagccc caggccctac tcttctggcc cggtgggctc agagaagccc       420
     cccaagggct ccagctataa cccgcctctg ccacccctga agatatctac ctctaatggc       480
     agtccagggt tcgactacca tcagcctgng gacaagtttg acgctagcaa gcagaacgac       540
     ctgngaggct gcaatgggac atcaaccatg actgtaatca aagattacta tgcactgaag       600
     gagaatgaaa tctgcgtgag ccaaagtgag gtggtacagg tcctcgccgt caaccagcag       660
     aacatgtgtc tggtgtacca gcctgccagc gaccattccc cggcagcaaa gggctgggtc       720
     ccaggcagca tcctggcgcc cttcgccaaa gccacagcag cggccgaaag tagtgacggg       780
     agcatcaaaa ccctactgaa accctagggg agaaaaggca tgccttccgt tgctacattt       840
     ggcccaccac gggactcact ggactggact tctatttata ttgtatgaag ttactgatat       900
     atatatattt ttttttttga ttggcaccta gaaatgacct tagcacaaat gccaggcctg       960
     gacaggtcag agcctgcttc ttctcccaaa agagagggga cttttttttt tttttttttt      1020
     ttggctgtcc acggcaattc cactgtacag attgtaactt tttattttta tttctctcct      1080
     cccctgtcac tttaatatat gttcatggta atttgtaaga tattcctttt ccttattttg      1140
     attgcaaaaa ctcttctgaa cacattcctg tataaagcat tttgcactat ttaaagaaac      1200
     ccttgtggat gaagtcaggt tgtgcaatat ggggagccgc aatgtttagc attgtacctg      1260
     taatgtaact aataatttta aatgtactat tttaaatatg taaaataaat tttcaccatg      1320
     agc                                                                    1323
//

If you have problems or comments...

PBIL Back to PBIL home page