(data stored in SCRATCH zone)

EMBL: AK010314

ID   AK010314; SV 1; linear; mRNA; HTC; MUS; 1879 BP.
XX
AC   AK010314;
XX
DT   08-FEB-2001 (Rel. 66, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 21)
XX
DE   Mus musculus ES cells cDNA, RIKEN full-length enriched library,
DE   clone:2400011D10 product:ATP synthase, H+ transporting mitochondrial F1
DE   complex, beta subunit, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1879
RA   Adachi J., Aizawa K., Akahira S., Akimura T., Arai A., Aono H., Arakawa T.,
RA   Bono H., Carninci P., Fukuda S., Fukunishi Y., Furuno M., Hanagaki T.,
RA   Hara A., Hayatsu N., Hiramoto K., Hiraoka T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Izawa M., Kasukawa T., Kato H., Kawai J., Kojima Y.,
RA   Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T., Miyazaki A.,
RA   Nishi K., Nomura K., Numazaki R., Ohno M., Okazaki Y., Okido T., Owa C.,
RA   Saito H., Saito R., Sakai C., Sakai K., Sano H., Sasaki D., Shibata K.,
RA   Shibata Y., Shinagawa A., Shiraki T., Sogabe Y., Suzuki H., Tagami M.,
RA   Tagawa A., Takahashi F., Tanaka T., Tejima Y., Toya T., Yamamura T.,
RA   Yasunishi A., Yoshida K., Yoshino M., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (10-JUL-2000) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; fbf8cbf2aa693df15a018d884b1e7456.
DR   Ensembl-Gn; ENSMUSG00000025393; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017847; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0017822; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0017785; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017786; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017609; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018241; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017170; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0017579; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0017685; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0017680; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0017759; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017708; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018281; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016955; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017229; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000026459; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0027443; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0027409; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0027380; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027387; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0027194; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0027894; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0026794; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0027125; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0027247; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0027239; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0027363; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0027221; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0027918; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0026495; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0026715; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=2400011D10
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1879
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="2400011D10"
FT                   /cell_type="ES cells"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        21..1610
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="ATP synthase, H+ transporting mitochondrial F1
FT                   complex, beta subunit (MGD|MGI:107801)"
FT                   /note="putative"
FT                   /db_xref="GOA:P56480"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="MGI:MGI:107801"
FT                   /db_xref="UniProtKB/Swiss-Prot:P56480"
FT                   /protein_id="BAB26846.1"
FT                   /translation="MLSLVGRVASASASGALRGLSPSAALPQAQLLLRAAPAGVHPARD
FT                   YAAQASAAPKAGTATGRIVAVIGAVVDVQFDEGLPPILNALEVQGRDSRLVLEVAQHLG
FT                   ESTVRTIAMDGTEGLVRGQKVLDSGAPIKIPVGPETLGRIMNVIGEPIDERGPIKTKQF
FT                   APIHAEAPEFIEMSVEQEILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELINN
FT                   VAKAHGGYSVFAGVGERTREGNDLYHEMIESGVINLKDATSKVALVYGQMNEPPGARAR
FT                   VALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMG
FT                   TMQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRAIAELGIYPAVD
FT                   PLDSTSRIMDPNIVGNEHYDVARGVQKILQDYKSLQDIIAILGMDELSEEDKLTVSRAR
FT                   KIQRFLSQPFQVAEVFTGHMGKLVPLKETIKGFQQILAGEYDHLPEQAFYMVGPIEEAV
FT                   AKADKLAEEHGS"
XX
SQ   Sequence 1879 BP; 456 A; 450 C; 514 G; 459 T; 0 other;
     gtctccaccc ggattccgcc atgttgagtc ttgtggggcg tgtggcctcg gcctcggcct        60
     ccggggcctt gcggggactc agcccttcgg cggctctgcc acaggcgcag cttctactgc       120
     gagctgctcc cgccggggtt catcctgcca gagactatgc ggcgcaggcg tctgcggccc       180
     cgaaggcagg cactgccacc gggcgaatcg tggcagtcat cggcgctgtg gtggacgtcc       240
     agttcgatga gggattacca cccatcctaa atgccctgga agtgcaaggc agggacagca       300
     gactggtttt ggaggtggcc cagcatttgg gggagagcac ggtcagaact attgctatgg       360
     atggcactga aggcttggtt agaggccaga aagtactgga ttcaggggca ccaatcaaaa       420
     ttcctgttgg tcctgagacc ttgggcagaa tcatgaatgt cattggagaa cctattgatg       480
     agagaggtcc tatcaaaacc aaacaatttg ctcctattca tgctgaggct cctgagttca       540
     tagagatgag tgttgagcag gagattctgg tgactgggat aaaggttgtg gatctgctgg       600
     ccccatacgc caagggtggg aaaatcggac tctttggagg tgctggcgtt ggaaagacag       660
     tactgatcat ggagctaatc aacaatgtcg ccaaagccca tggtggttac tctgtatttg       720
     ctggtgttgg tgagaggacc cgtgagggca atgatttata ccatgaaatg attgaatctg       780
     gtgttatcaa tctaaaagat gccacttcca aggtagcgtt ggtatatgga cagatgaacg       840
     aaccacctgg cgctcgagcc cgggtagctc tgactggttt gaccgttgct gaatacttca       900
     gagaccagga gggccaagat gtcctgctgt ttattgacaa catcttccgc tttacccagg       960
     ctggctcaga ggtgtctgcc ttattgggca gaatcccttc tgctgtaggc taccagccca      1020
     ccctagccac cgacatgggc acaatgcagg aaaggatcac caccaccaag aagggatcga      1080
     tcacctcggt gcaggctatc tatgtgcctg ctgatgacct gactgaccct gcccctgcaa      1140
     ccacctttgc ccatttggat gctaccactg tgttgtcccg ggctattgct gagttgggca      1200
     tctatccagc tgtggatcca ctggactcca cctctcgaat tatggatccc aacattgttg      1260
     gcaatgagca ttatgacgtc gcccgaggag tgcagaaaat cctgcaggac tacaaatctc      1320
     tccaggacat cattgccatc ttgggtatgg atgaactttc tgaggaagat aaattgactg      1380
     tgtcccgggc aagaaagata cagcgcttct tgtctcagcc attccaagtt gctgaggtct      1440
     tcacgggtca catggggaag ctggtgccct tgaaggagac cattaaagga ttccagcaga      1500
     ttttagcagg tgaatatgac catctcccag aacaagcctt ctacatggtg ggacccattg      1560
     aagaagccgt ggcaaaggct gataagctgg cagaagagca cgggtcgtga gggactccag      1620
     ccaaaggcag cactgcaact gatctctcca tatcaagcga gagctcaggt ttccttccat      1680
     gcaggccaca caagagcctt gattgaagat gtgatgttct ctctgaagag tatttaaagt      1740
     tttcaataaa gtatataccc ctcatttatg tctgtttatg ttgcttctga aacagcttat      1800
     aattgagctc acagtggtgg gccacattta ggaaattgtt agaaacagga ttattattaa      1860
     aaagatcaat ttattaagg                                                   1879
//

If you have problems or comments...

PBIL Back to PBIL home page