(data stored in SCRATCH zone)

EMBL: AK013455

ID   AK013455; SV 1; linear; mRNA; HTC; MUS; 987 BP.
XX
AC   AK013455;
XX
DT   08-FEB-2001 (Rel. 66, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 20)
XX
DE   Mus musculus 10, 11 days embryo whole body cDNA, RIKEN full-length enriched
DE   library, clone:2810490K17 product:hypothetical protein, full insert
DE   sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-987
RA   Adachi J., Aizawa K., Akahira S., Akimura T., Arai A., Aono H., Arakawa T.,
RA   Bono H., Carninci P., Fukuda S., Fukunishi Y., Furuno M., Hanagaki T.,
RA   Hara A., Hayatsu N., Hiramoto K., Hiraoka T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Izawa M., Kasukawa T., Kato H., Kawai J., Kojima Y.,
RA   Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T., Miyazaki A.,
RA   Nishi K., Nomura K., Numazaki R., Ohno M., Okazaki Y., Okido T., Owa C.,
RA   Saito H., Saito R., Sakai C., Sakai K., Sano H., Sasaki D., Shibata K.,
RA   Shibata Y., Shinagawa A., Shiraki T., Sogabe Y., Suzuki H., Tagami M.,
RA   Tagawa A., Takahashi F., Tanaka T., Tejima Y., Toya T., Yamamura T.,
RA   Yasunishi A., Yoshida K., Yoshino M., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (10-JUL-2000) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 718a9d001df1c68e81a3bc8ad31a72b0.
DR   Ensembl-Gn; ENSMUSG00000025353; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017885; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0017860; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0017823; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017824; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017647; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018279; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017208; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0017617; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0017723; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0017718; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0017797; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017746; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018319; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016993; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017267; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000026409; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000217685; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000219215; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000219524; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0027547; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0027519; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0027483; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027496; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0027305; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0028003; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0026901; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0027234; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0027356; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0027342; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0027470; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0027332; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0028027; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0026606; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0026823; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=2810490K17
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..987
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="10, 11 days embryo"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="2810490K17"
FT                   /tissue_type="whole body"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        144..605
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="hypothetical protein (evidence:
FT                   rsCDS,ProCrest,decoder,NCBI CDS Predictor,Longest-ORF)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q9CQZ0"
FT                   /db_xref="InterPro:IPR007203"
FT                   /db_xref="InterPro:IPR029886"
FT                   /db_xref="MGI:MGI:1914094"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CQZ0"
FT                   /protein_id="BAB28864.1"
FT                   /translation="MNVGVAHSEVNPNTRVMNSRGIWLAYIILVGLLHVVLLSIPFFSI
FT                   PVVWTLTNVIHNLAMYIFLHTVKGTPFETPDQGKARLLTHWEQMDYGLQFTSSRKFLSI
FT                   SPIVLYLLASFYTKYDAAHFLINTASLLSVLLPKLPQFHGVRLFGINKY"
XX
SQ   Sequence 987 BP; 246 A; 244 C; 227 G; 270 T; 0 other;
     ggagaccaca ggtgtaagag ccagcgctgt gccccaagcc ggacgggctc ctgaagctgg        60
     caggagacag cgggggaaca agctcaatca gggctaatga ggagactgag ttggactcct       120
     gcctgatccc tcactgtggt aggatgaatg tgggggtggc acacagcgaa gtaaacccca       180
     acactcgagt gatgaacagt cggggcatct ggctggccta catcatcttg gtaggactgc       240
     tgcatgtggt tctcctcagc atccctttct tcagcattcc tgttgtctgg accctgacca       300
     acgtcatcca taacttggca atgtatatct tcctacatac agtcaaaggg acgccctttg       360
     agacccctga ccaaggaaag gctcggcttt tgacacattg ggagcagatg gactatggac       420
     tacagtttac ctcctcgcga aagttcctca gcatctctcc tattgtactt tacctcctgg       480
     ccagcttcta caccaagtac gatgctgctc acttcctcat caacactgcc tcgctgctca       540
     gcgtgctgct gcctaagcta ccccagttcc atggggttcg tctctttgga atcaacaaat       600
     actaaaagat ggtttgctag ttctgcaggc attgagggaa ggcactggaa ctaatatata       660
     atgttttccc tttctccaca ctatcttctg tatcttggaa gcctgagaga taagataaac       720
     ctatctaaac tccaagaagg aagaaactgg aaaatggggt tcctgggtcc agtcttcata       780
     gggtcaagat tctctgaatc aggaaaggtg gatgaggtta agggcactac cactcactct       840
     cctctatcta gcaagaagcc atcattgttt gggcagcttt tctggtgatt atgtttttcc       900
     atatcttcta aacctaccaa cttcaagttc tgttttgctg tatatttttc ttaaaataaa       960
     gtctttcagt tatggctgaa atttgat                                           987
//

If you have problems or comments...

PBIL Back to PBIL home page